KEGG   Gluconobacter oxydans 621H: GOX0161Help
Entry
GOX0161           CDS       T00230                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
gox  Gluconobacter oxydans 621H
Pathway
gox00473  D-Alanine metabolism
gox00550  Peptidoglycan biosynthesis
gox01100  Metabolic pathways
gox01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gox00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    GOX0161
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    GOX0161
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    GOX0161
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gox01011]
    GOX0161
Enzymes [BR:gox01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     GOX0161
Peptidoglycan biosynthesis and degradation proteins [BR:gox01011]
 Precursor biosynthesis
  Amino acid ligase
   GOX0161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AAW59954
UniProt: Q5FUJ2
LinkDB All DBs
Position
177613..178524
Genome map
AA seq 303 aa AA seqDB search
MKVAVLLGGTSSERPVSLVSGEAAIEALREKGHDVTPIDVGPDIATTIASLKAAAPDVVF
NALHGPRGEDGAIQGVLEWLGLPYTHSGIRASAVAMDKGATRILLAAAGLPVAQGRVVTV
EELAEADPLPAPYVIKPVAEGSSVGVEIVRTGDNRRAEIARTWRFGKEALVESFIPGREL
TAGVMGDRALAVTDILPSETAAFYDFEAKYKAGGSRHVVPAELPQAVTDRALDYALRAHQ
TLGCQGASRTDFRYDEGTDTLVILEVNTQPGMTPTSLLPEQAAYCGISYPELCDWMVREA
LAR
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcgcagtcctgttggggggaacatccagtgagcggcctgtcagtctcgtcagt
ggcgaggccgcaatcgaggccctgcgcgaaaagggacacgacgtcaccccgatcgatgtc
ggaccggatatcgcaacgaccatcgccagcctgaaagccgccgcaccggacgtcgttttc
aacgccctgcacggcccccgtggcgaagacggtgccattcagggcgttctggaatggctt
ggcctgccctacacccattccggcatccgcgcctcggccgtggcaatggacaaaggcgca
acccgcatccttctggccgccgccggtctgcccgtggcgcaaggacgtgtcgtgacggtt
gaagagctggccgaagccgatccgctccccgcaccctatgtcatcaagccggtcgcagaa
ggttcctccgtcggtgtcgagatcgtgcggacgggagacaaccgtcgcgccgaaatcgcg
cggacttggcgtttcgggaaagaggcattggtcgagagcttcattcccggtcgcgagctg
accgcaggcgttatgggcgaccgggctctggccgttacggacatcctgcccagcgaaacg
gctgcgttttatgatttcgaggccaaatacaaggctggcggctcacggcacgtggtccct
gcggagcttccgcaggcggtgacagaccgtgcgcttgattacgccctgcgcgcccatcag
acactgggctgtcagggggccagccgcacggatttccgctacgatgagggcaccgacacg
ctggtcatcctcgaggtcaacacacagcccggcatgacaccgacatccctgctgccggaa
caggccgcctattgcgggatttcctatccggaactgtgtgactggatggtccgggaggca
ctggcgcgctga

DBGET integrated database retrieval system