KEGG   Gluconobacter oxydans 621H: GOX0818
Entry
GOX0818           CDS       T00230                                 

Definition
(GenBank) Sensor protein ChvG
  KO
K14980  two-component system, OmpR family, sensor histidine kinase ChvG [EC:2.7.13.3]
Organism
gox  Gluconobacter oxydans 621H
Pathway
gox02020  Two-component system
Brite
KEGG Orthology (KO) [BR:gox00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GOX0818
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gox01001]
    GOX0818
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:gox02022]
    GOX0818
Enzymes [BR:gox01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     GOX0818
Protein kinases [BR:gox01001]
 Histidine kinases
  OmpR family
   GOX0818
Two-component system [BR:gox02022]
 OmpR family
  ChvG-ChvI (acidity sensing)
   GOX0818
SSDB
Motif
Pfam: Stimulus_sens_1 HATPase_c HisKA Sensor_TM1 HAMP
Other DBs
NCBI-ProteinID: AAW60592
UniProt: Q5FSQ4
LinkDB
Position
complement(885473..887311)
AA seq 612 aa
MDDDAASFPTGHALDVDRLEQGRDRRRAESARAGLGESLRSVGAKILRRLRPRRASEISL
SRRRLASPLLVRILLLNALPLALLAVTLLFLDQFQNGLLETDVNALREQAHIYAGALGQS
AVRVSAHAPGHPAPGGNLELDVAQARPLLARLTEPSPNAHALLFDPDGKLVVDSRTASRG
KQDHAAPDPVDGGSWQPPRNNILESFYDWLLSLLPLTSSEEVTLDTNDTAMDGPHDAQPF
HSQAELPPFIRRTKDHQLVVTVVEPVVRDGVTVGEIQLTRHAPEVDRTLFAVRSSILSLV
LAALVVTVLLSWYLSLTIARPLLTLARASNDMRETDGRKDLVPERLLARRDEIGVLARSL
RGSALALWARMDDIERFAADVSHEIKNPLSSIRSAIETLPRIQIAERRERLLGIINSDVK
RLDRLITDISDASRIDAELSRVRPEPVSVVALLSILAEMHQTTRRENDPVLRLDVRDQDP
PLKALAVEDRLVQVLRNLIGNAVSFSPPKGIIALHASARDIAGEGPGTGSVVEITITDQG
PGIPPGKLDSIFDRFYSERPQTENFGQHSGLGLAISRQIIHALRGSLFAENRMDASGAIR
GACFVVRLPRAP
NT seq 1839 nt   +upstreamnt  +downstreamnt
gtggatgacgacgccgcctccttcccgacaggtcacgcgctcgacgtcgaccggctcgaa
cagggccgcgaccggcgccgtgccgaatcggcccgcgcggggctgggcgagtccctgcgg
agtgtcggcgcaaagatcctgaggcgtctgcgcccccgccgggcgtcggagatctccctg
tcgcgccggcgtctggcttcaccgcttctggtgcggatcctgctgctcaacgccctgccg
cttgcgcttctggccgtcacgctgctgtttctggaccagttccagaacggtctgctggaa
accgacgtcaacgccctgcgcgagcaggcccatatctatgccggagccctcggccagtcc
gccgtccgggtcagcgcccatgcgcccggccatccggcgcccggcggcaatctggagctg
gacgtcgcgcaggcccgccccctgttggcccgtctgaccgaaccgagccccaacgcccat
gccctgctgttcgatccggacggcaagcttgtcgtggacagtcgcacggcctcgcgcggc
aaacaggatcatgccgctcccgatcctgtcgatggaggatcgtggcagccgccccggaac
aatattctcgaaagtttctacgactggctgctgtcgctcctgccgctgacctccagcgag
gaagtgacgctcgacaccaatgacaccgccatggacggcccgcatgatgcccagccgttc
cattcccaggcggaactgccgcctttcatccggcgcaccaaggaccatcagcttgtcgtg
acggtcgtggagcctgtcgtgcgcgatggcgtgacggttggcgaaatccagctcacccgc
cacgcaccagaagtggatcgcacgctgtttgccgtccgctcctcgatcctgtcgctggtg
ctggcggcgctggtcgtgacggtcctgctgtcctggtatctgtcgctcacgatcgcccgg
ccgctgctgacgctggcgcgtgcgtccaacgacatgcgcgagacggatggccgcaaggac
ctcgtgcccgagcggcttctggcgcggcgtgatgaaatcggcgttttggcacgctcgctc
cggggcagcgcgctcgcgctctgggcgcggatggacgacatcgaacgctttgccgccgat
gtcagtcacgagatcaagaacccgctctcctccatccgctcggccatcgagacgcttccg
cgcatccagatcgctgaacggcgcgaacggctccttggcatcatcaatagtgacgtcaaa
cggctcgaccgcctgattacggacatttccgacgccagccgcattgacgcggaactctcc
cgcgtgcgccctgagccggtctccgtcgtggcccttctgtccattctggcggaaatgcat
cagacgacgcgccgggaaaacgatcccgtgctccggcttgatgtccgcgatcaggacccg
ccgctgaaggcgctggccgtggaggaccgtctggtgcaggtcctgcgcaacctgatcggc
aatgcggtgtcgttctcgccgccaaagggcatcatcgccctgcatgccagcgcgcgcgac
attgccggggaagggcccgggaccggcagtgtggttgaaatcaccatcaccgatcagggc
cctggcattccgcccggaaagctcgacagcattttcgaccgtttctattcagagcggccc
cagaccgagaacttcggccagcattccggactcggcctcgcgatcagccggcagatcatt
cacgccctgcgcggcagtctgttcgccgagaaccgcatggatgcgtccggggcgatccgc
ggcgcctgcttcgtggtgcgactgccccgcgcgccctga

DBGET integrated database retrieval system