KEGG   Gluconobacter oxydans DSM 3504: GLS_c24350Help
Entry
GLS_c24350        CDS       T03563                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoyllysine-residue acetyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
goy  Gluconobacter oxydans DSM 3504
Pathway
goy00010  Glycolysis / Gluconeogenesis
goy00020  Citrate cycle (TCA cycle)
goy00620  Pyruvate metabolism
goy01100  Metabolic pathways
goy01110  Biosynthesis of secondary metabolites
goy01120  Microbial metabolism in diverse environments
goy01130  Biosynthesis of antibiotics
goy01200  Carbon metabolism
Module
goy_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:goy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GLS_c24350 (pdhC)
   00020 Citrate cycle (TCA cycle)
    GLS_c24350 (pdhC)
   00620 Pyruvate metabolism
    GLS_c24350 (pdhC)
Enzymes [BR:goy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     GLS_c24350 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 QRPTase_N Ribosom_S12_S23
Motif
Other DBs
NCBI-ProteinID: AHK72303
UniProt: A0A067Z6V7
LinkDB All DBs
Position
2775968..2777179
Genome map
AA seq 403 aa AA seqDB search
MPALSPTMTEGKLARWLKAEGDTVSAGDVIAEIETDKATMEVEAVDEGILGRILIQEGVE
GIPVNTPIAVLVEEGEAVPEASSTQAPAAPKAEAAPAVSTGTAPAKAAPEEKGERIFVSP
LARRMARERGIALDALTGSGPNGRILKRDVEKGVTAPKTAPKAVPSATPVAASEETVRRV
PNSTMRKVIARRLTESKTQVPHFYVSVDIELDALLELRSKLNATAQENSFKISVNDMMIK
AVALALKKVPGVNVQFTDAETLHFENVDISMAVSVPDGLITPIIRNADRKSLRQISVEAK
DLAKRARAGKLKPEEFQGGTFSISNMGMFGVREFAAIINPPQAGILAIASGEKRAVVRGS
EIAVATVMTATLSVDHRAVDGALGAEWLNALRDIVQNPYTLVV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgccggcgctgtcgccgaccatgaccgagggcaaactggcccgctggcttaaagccgag
ggcgataccgtctccgctggcgacgtgattgccgagatcgagaccgacaaggcgaccatg
gaagtagaagccgtggacgagggcattcttggccgcatcctgatccaggaaggcgtcgaa
ggcattcccgtcaacacgccgatcgcggttcttgtggaagagggggaggctgtgccggaa
gcctcttccacgcaggcgccagcggccccgaaagccgaggccgctccggccgtatcgacg
gggactgcgcctgcaaaagctgcgccagaagagaaaggcgaacgaattttcgtctctccg
ctggcccgccgcatggcgcgtgagcgaggcattgccctcgatgcactgacgggaagcggc
ccgaacggccgtattctcaagcgcgatgtggaaaagggcgtgacggctccgaagactgcg
ccgaaagcagttccgtcagcgacacccgttgctgcttcggaagagacggtgcgtcgcgtt
ccgaactccacgatgcgcaaggtcattgcgcggcgtctgacggagtccaaaacgcaggtg
ccgcatttctatgtctcggtcgatatcgagttggatgcactgctggaactgcgttcgaag
ctgaatgccactgcacaggaaaacagcttcaagatttccgtcaatgacatgatgatcaag
gccgttgcgctagcgctgaagaaggtgccgggtgtgaacgtgcagttcacggatgccgag
acgctgcatttcgaaaatgtggacatatcgatggctgtgtcggtgccggacggcctgatc
acgccgatcatccgcaacgccgatcgcaagtccctgcgccagatcagcgtcgaagccaag
gatctggccaagcgcgcccgtgccggaaagctcaagcccgaggaattccaaggcggcacg
ttctccatttccaacatgggcatgttcggcgtgcgcgagttcgcggcgatcatcaatccg
ccgcaggccggtattctggcgattgcctcgggtgagaagcgggccgtggtgcgtggatca
gaaattgcggttgcgaccgtgatgacggcgacgctttcggtcgatcaccgtgccgtcgat
ggcgcgcttggtgccgaatggcttaatgcactgcgcgatatcgtgcagaacccttacact
ctggtggtctga

DBGET integrated database retrieval system