KEGG   Gordonibacter pamelaeae: GPA_11840Help
Entry
GPA_11840         CDS       T02609                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
gpa  Gordonibacter pamelaeae
Pathway
gpa00473  D-Alanine metabolism
gpa00550  Peptidoglycan biosynthesis
gpa01100  Metabolic pathways
gpa01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gpa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    GPA_11840
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    GPA_11840
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    GPA_11840
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gpa01011]
    GPA_11840
Enzymes [BR:gpa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     GPA_11840
Peptidoglycan biosynthesis and degradation proteins [BR:gpa01011]
 Precursor biosynthesis
  Amino acid ligase
   GPA_11840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp_3 CPSase_L_D2 GARS_A TTL ParG
Motif
Other DBs
NCBI-ProteinID: CBL03863
UniProt: D6E816
LinkDB All DBs
Position
complement(1176778..1177770)
Genome map
AA seq 330 aa AA seqDB search
MGMKVAVLMGGASFEREFSLASGKNVCAALEEAGHKVVPLDTTADLVPTLRTERPDVCYS
ALHGKHGEDGTIQSLLEFLDIPFVGSPSHVCHRTWNKDSMHYELATYRAITGDAPIASWP
QGIYLARDAFKDMGAATALDLVQERVIGGYPVAVKPAHGGSAMGVHRVDSVDELGEAILD
ALSFDEAVVIEQWVEGVEMAVSVLGTGWDAYALPPVEIVPKQGFFGTEARMEPGAVQYIA
PVRPASLSDDEGDAQAIRAEIERAALEVYRAYNARDLARVDLIWDGAQARVFEVNVSPGM
AERSLFPAACEAAGLSLSSVLNELVTQYAK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgggcatgaaagttgcagtgttgatgggcggcgcttcgttcgagcgcgagttttccctg
gccagtggcaagaacgtgtgcgcggcgctcgaggaggccggccacaaggtggtgccgctg
gacaccacggccgacctcgttcccacgctgcgcaccgagcgtcccgacgtgtgctacagc
gccctgcacggcaagcacggcgaggacggcaccatccagagcctgctggagttcctggac
atcccgttcgtcggctcgccgtcgcacgtgtgccaccgcacgtggaacaaggactccatg
cactacgagctggctacgtaccgcgccattaccggcgatgcccccatcgcctcgtggccg
cagggcatctacctggcgcgcgacgccttcaaggacatgggcgccgccacggcgctcgac
ctggtgcaggaacgcgtgattggcggctaccccgtggcggtgaagcccgcgcacggcgga
agcgccatgggagtgcaccgcgtggattccgtcgacgagctgggcgaggccatcctcgat
gcgctctcgttcgacgaggccgtggtcatcgagcagtgggtggaaggcgtggagatggcc
gtgtcggtgctcggcaccggctgggacgcctacgcgctgccgccggtcgagatcgtgccc
aagcagggcttcttcggcaccgaggcgcgcatggagcccggcgccgtgcagtacatcgcg
cccgtgcgccccgcctcgctgtccgacgacgagggcgacgcccaggccatccgcgccgag
atcgagcgcgccgcgctggaggtctaccgggcctacaacgcccgcgacctcgcccgcgtc
gacctcatctgggatggcgcccaggcccgcgtcttcgaggtgaacgtgtcgcccggcatg
gccgagcgctccctgttccccgccgcctgcgaggccgccggcctctccctctccagcgta
ttgaacgagctggtaacgcagtacgcgaagtaa

DBGET integrated database retrieval system