KEGG   Gordonibacter pamelaeae: GPA_26020Help
Entry
GPA_26020         CDS       T02609                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
gpa  Gordonibacter pamelaeae
Pathway
gpa00410  beta-Alanine metabolism
gpa00430  Taurine and hypotaurine metabolism
gpa00650  Butanoate metabolism
gpa01100  Metabolic pathways
gpa01110  Biosynthesis of secondary metabolites
gpa01120  Microbial metabolism in diverse environments
gpa02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:gpa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    GPA_26020
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    GPA_26020
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GPA_26020
   00430 Taurine and hypotaurine metabolism
    GPA_26020
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    GPA_26020
Enzymes [BR:gpa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     GPA_26020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Acetyltransf_14
Motif
Other DBs
NCBI-ProteinID: CBL04696
UniProt: D6EAE9
LinkDB All DBs
Position
complement(2610983..2612473)
Genome map
AA seq 496 aa AA seqDB search
MKEQTSTSKILDSMDEGTKYSTPIFGSEASDVAMPRLKMNDQPVEPRIAYEMIKEYLSIE
GNATQNLTTFCQTYMEPMATKIMAETMEKNAIDKDEYPMTADLENRCVAMIGDLWHADPA
EEPMGTSTVGSSEACMLGGLGMLFRWKKLAKDAGIDIYTEQRPNLVISAGYQVCWEKFCR
YWDIEMRLVPLEKDHLSLNMDTVMDYVDDHTIGITAILGITYTGKFDDVQKLDELVEAYN
QEHPKLPIRIHVDGASGGMFAPFVEPDLVWDFQLKNVWSINCSGHKYGLVYPGIGWVVWR
SKEALPEDLIFWVSYLGGEEATMAINFSRSASQIVGQYYVLMRNGFEGFKEIQERTLDVA
RYLAAELKEMGIFEIYEDASHIPIVCWGLKDDADVEWSLYDLSDRLRMSGWLVPAYPMPA
DMQDTTVQRVVARADFSMQLCIKLVEDMKKEMDTLNKAKFVTGNTQGVIQTGFNHGGRSA
VDKGEKVQTKAKTTQK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaacagacatctaccagcaagatcctcgatagcatggacgaaggcaccaagtac
tcgacgcccatcttcggctccgaggcatccgatgtggccatgccgcgcctcaagatgaac
gaccagccggtcgagccgcgcatcgcctacgagatgatcaaggagtacctgtccatcgag
ggcaacgccacgcagaacctcaccacgttctgccagacctacatggagcccatggccacg
aagatcatggccgagacgatggagaagaacgccatcgacaaggacgagtaccccatgacg
gccgacctcgagaaccgctgcgtcgccatgatcggcgatctgtggcatgccgacccggcc
gaggagcccatgggcacgtccaccgtcggctcgtccgaggcctgcatgctgggcggcctc
ggcatgctgttccgctggaagaagctggcgaaggacgccggcatcgacatctacaccgag
cagcgcccgaacctggtgatctccgcaggctaccaggtgtgctgggagaagttctgccgc
tattgggacatcgagatgcgcctcgtgccgcttgagaaggaccatctgtcgctgaacatg
gacacggtcatggactacgtggacgaccacaccatcggcattacggccatcctcggcatc
acctacaccggcaagttcgacgacgtgcagaagctcgacgagctggtggaagcgtacaac
caggagcatccgaagctgccgatccgcatccacgtcgacggcgcgtcgggcggcatgttc
gccccgttcgtggagcccgacctggtgtgggacttccagctgaagaacgtgtggtccatc
aactgctccggccataagtacggcctcgtgtaccccggcatcggctgggtggtgtggcgc
agcaaggaagcgctgcccgaggacctgatcttctgggtgagctacctgggcggcgaggag
gccacgatggccatcaacttctcgcgcagcgcctcgcagatcgtgggccagtactacgtg
ctcatgcgcaacggcttcgagggcttcaaggagatccaggagcgcacgctcgacgtggcg
cgctacctggccgccgagctcaaggagatgggcatcttcgagatctacgaggatgcgtcg
cacattccgatcgtgtgctggggcctgaaggacgacgccgacgtggagtggtcgctgtac
gacctgtccgaccgcctgcgcatgagcggctggctggtgcccgcgtacccgatgcccgcc
gatatgcaggacaccaccgtccagcgcgtcgtggcgcgcgccgacttctcgatgcagctg
tgtatcaagctggtcgaggatatgaagaaggagatggacacgctgaacaaggcgaagttc
gtcaccggcaacacccagggcgtcatccagaccggcttcaaccacggcggccgctctgcc
gtcgacaagggcgagaaggtccagacgaaggcgaagaccacgcagaagtaa

DBGET integrated database retrieval system