KEGG   Gamma proteobacterium HdN1: HDN1F_02020Help
Entry
HDN1F_02020       CDS       T01300                                 

Definition
(GenBank) Putative glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
gpb00250  Alanine, aspartate and glutamate metabolism
gpb00410  beta-Alanine metabolism
gpb00430  Taurine and hypotaurine metabolism
gpb00650  Butanoate metabolism
gpb01100  Metabolic pathways
gpb01110  Biosynthesis of secondary metabolites
gpb01120  Microbial metabolism in diverse environments
gpb02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:gpb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    HDN1F_02020
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HDN1F_02020
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HDN1F_02020
   00430 Taurine and hypotaurine metabolism
    HDN1F_02020
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    HDN1F_02020
Enzymes [BR:gpb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     HDN1F_02020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: CBL43785
UniProt: E1VG43
LinkDB All DBs
Position
260893..262569
Genome map
AA seq 558 aa AA seqDB search
MHQDKRPATQRFAEANMDAMYRIFTVPEAPGSTLGQIDNMISQNLMGFLQNHIVAVEKDL
SEVEKDFADAHIPEKPWFVSDQTQFLLDKLVAQSVHTASPSFVGHMTSALPYFMLPLSRI
MMALNQNLVKIETSKAFTPLERQVLGMMHRLIYERDDKFYDQWMHKSGHSLGVLCSGGTI
ANMTALWVARNAMFKPSKGFKGINHTGVFGALKHHGLEGMAVLVSERGHYSLAKAADVLG
IGRDHLLTVRTDDNNKVNIRKMRQKLEECRSRNIGVMAIVGVCGTSETGTVDPLNDLADL
AEEFGCHYHVDAAWGGATLFSQKYSHILEGIRRADSVTIDGHKQLYVPMGAGMVFFKNPT
ALSNIQHHAEYIIRQGSKDLGSHTLEGSRPGMAMLVHSGLRIIGRSGYEILINEGIEKAR
AFADMVRAEPDFEMITEPELNILTYRYVPEFVKKKLATANAREIDHIHDLLNRLTKLIQK
TQRARGKSFVSRTRLTPEKYGHRLTVVFRVVLANPLTNHQILRGVLEEQRTIASLEDCQQ
LLRQLSEACAEARHVSNG
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaggataaacgcccggctacgcaacgctttgcggaagccaatatggatgccatg
tacaggatttttacggttcctgaagcgccgggttcgaccttgggccagattgacaatatg
atcagtcagaacctgatgggctttctgcagaaccacatcgtcgcggttgaaaaggacctc
tcggaagtcgaaaaagacttcgcagacgcccacattcccgaaaaaccttggtttgtgtcc
gatcaaacccagtttttgttggacaaactggttgcgcagtcggtgcacaccgcatcgccg
agttttgttggacatatgacgtccgcgctgccgtatttcatgctgccgctttcgcgcatc
atgatggcgctgaaccaaaacctcgtaaaaatcgaaacctccaaggcgttcacaccgctg
gaacgtcaggtgctcggcatgatgcaccgcctgatttatgagcgtgacgacaagttttac
gatcaatggatgcacaaaagcggccactcactcggcgtgttatgttcgggtggaaccatc
gccaacatgacggcactttgggtggctcgaaatgccatgttcaaaccgtcgaaaggcttc
aaaggcatcaatcataccggcgtgtttggtgcgctaaagcaccacggcctagagggaatg
gcggttctggtatcggagcgcggccattattcacttgccaaagctgccgacgtattagga
attggccgcgatcatttattaacggttcgtaccgacgataacaacaaggtcaatatccgc
aagatgcgccaaaagctcgaagaatgccgctcgcgcaatatcggcgtgatggccattgtg
ggcgtctgcggcacgtctgaaaccggcaccgtagatccgttgaatgatctggccgatctc
gctgaagaatttggctgccactaccacgtagacgcggcatggggcggcgctacgctcttc
tcccaaaaatattcccacatccttgaaggaatccgccgcgcagactcggtcaccatcgac
ggtcacaaacagctatacgtaccgatgggcgcagggatggtgttcttcaagaatccaacg
gcgctctccaacatccagcaccacgccgaatacattatccgccaaggctccaaggatttg
ggctcgcacaccctagaaggttcacgccccggtatggcgatgcttgtacattccggctta
cgaatcatcgggcgcagcggctacgaaatcctcatcaatgagggcatcgaaaaggcgcgc
gcatttgccgatatggttcgcgccgaacctgatttcgaaatgattaccgagccagaactc
aatattctgacctatcgctacgttcccgaatttgtgaagaaaaagctcgcaaccgccaac
gcacgcgaaattgatcatattcacgatctgctcaaccggctcaccaaattgatccagaaa
acccagcgcgcgcgcggaaaatcctttgtttcgcgcacccgcctaacgcctgaaaagtac
ggccaccgcttaacggtagtgttccgtgtagtgctggcgaatccgctcaccaatcaccag
attttgcgcggcgttctagaagagcaacgcacgattgcctctcttgaagactgccagcag
ctattgcgccaattgagcgaggcttgcgccgaagctcgccacgtgagcaacggttag

DBGET integrated database retrieval system