KEGG   Gamma proteobacterium HdN1: HDN1F_04400Help
Entry
HDN1F_04400       CDS       T01300                                 

Gene name
dacA
Definition
(GenBank) Penicillin-binding protein 5 precursor (D-ala-D-ala-carboxypeptidase)
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
gpb00550  Peptidoglycan biosynthesis
gpb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gpb00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HDN1F_04400 (dacA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gpb01002]
    HDN1F_04400 (dacA)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gpb01011]
    HDN1F_04400 (dacA)
Enzymes [BR:gpb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     HDN1F_04400 (dacA)
Peptidases and inhibitors [BR:gpb01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   HDN1F_04400 (dacA)
Peptidoglycan biosynthesis and degradation proteins [BR:gpb01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   HDN1F_04400 (dacA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: CBL44023
UniProt: E1VGT1
LinkDB All DBs
Position
complement(537749..538906)
Genome map
AA seq 385 aa AA seqDB search
MIGFIANTLFIGALTASNASFAAETELPTPPQLAASSWILIEPSSGQVLVEHNADEQLPP
ASLTKMMTSYVAADKIKEGLAGWDDEVLVSEKAWRMGGSKMFIRVGTQVKIRDLMRGIII
QSGNDASVALAEHIAGSEESFADLMNQTAKRIGMTHTHYVNATGLPDPSHYTTARDLAIL
AQHVIFDHPEDYELYSEKEFLYNNIKQPNRNLLLWRDNSVDGIKTGHTKEAGYCLVASAK
RDGMRLVAVVMNTNSEKARASETMKLLTYGFRFYENVRSYSAGEVLAAPEIWFGSTPTVK
LGLDKDLVLTIPRGTQQDVKAELDYKPLELKAPIAKGQQLGVIRVRVKDKVISETPLVAL
EPVEEAGFIKKLWHHLLLFVKGLFS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
ttgatcggattcattgcaaacacgctgtttataggtgcgctcaccgcaagcaacgcaagc
ttcgccgccgaaaccgaattacccacaccgccgcaactggccgccagctcttggattttg
atcgaacccagcagcgggcaagtccttgtcgagcacaatgcagatgagcaattgccacct
gccagcctcaccaaaatgatgacctcctacgttgccgccgacaaaatcaaagagggcctt
gccggttgggacgacgaagtacttgtcagcgaaaaagcatggcgcatgggcggctcaaaa
atgttcattcgcgtgggcacccaagtaaaaatccgtgatctcatgcgcggaatcattatc
cagtccggcaacgacgcctccgttgcactcgccgaacacatcgccggtagcgaagaatca
ttcgcagatcttatgaatcaaaccgccaaacgcatcggcatgacccacacccactacgtc
aacgccaccggcctgcccgacccctcgcactacaccaccgcacgcgaccttgcgatcctt
gcccagcacgtaatttttgaccatcctgaagactacgaactctattccgaaaaagaattc
ctctacaacaacatcaagcaacccaaccgcaacctactgctctggcgcgacaacagcgta
gacggcatcaaaaccggccacaccaaagaagcgggctattgcttggtcgcctctgccaaa
cgtgacggaatgcgcctagtcgccgttgtcatgaacaccaacagcgagaaagcccgcgcc
agcgaaaccatgaagctgctcacctacggcttccggttttacgaaaacgtacgcagctac
agcgccggtgaagtcctcgccgcccccgaaatctggttcggcagcacccccaccgtcaaa
ctcggccttgataaagaccttgtcctcacgatcccacgaggcacacagcaggatgtaaaa
gctgaacttgactacaaaccactagaactcaaggcccccattgccaaaggtcagcagcta
ggcgtgattcgagtgcgagtgaaagacaaggtcatctcggaaacgcctctcgtagcgctc
gaaccggtggaagaagcgggcttcatcaaaaaactctggcaccacttactcctgtttgtg
aaaggcctgttttcctga

DBGET integrated database retrieval system