KEGG   Gamma proteobacterium HdN1: HDN1F_04440Help
Entry
HDN1F_04440       CDS       T01300                                 

Gene name
pbpX
Definition
(GenBank) Penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
gpb00550  Peptidoglycan biosynthesis
gpb01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:gpb00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HDN1F_04440 (pbpX)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    HDN1F_04440 (pbpX)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gpb01011]
    HDN1F_04440 (pbpX)
Enzymes [BR:gpb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     HDN1F_04440 (pbpX)
Peptidoglycan biosynthesis and degradation proteins [BR:gpb01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   HDN1F_04440 (pbpX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: CBL44027
UniProt: E1VGT5
LinkDB All DBs
Position
complement(542485..544449)
Genome map
AA seq 654 aa AA seqDB search
MARNVTFHDKLREQGIFKHRLVVAFLGVLALVGVLLLRMYHLQIVQYSTYETISDRNRIQ
IEPIAPTRGLILDRNGTILADNNPTFSVSIIKELVPNLSQTIADIRELIPLNDNDVQRFE
KRLQQRRRPLTPIALRLNLTEEEIAILSVRAYDLPGVIIEANLVRHYPQPELLSHTIGYV
GRINEAELKQVDANNYGATEYIGKTGIEKFYEDRLHGTVGFQKVETDARGRTTRVLEKID
PTGGENLHLFLDLPTQQAALKAMNGRRGAVVAIEPDTGGVLAFLSTPGFNSNLFVTGIDH
KSYNDLQNDRWRPLFNRALQGQYPPGSTVKPMVGLAGLDGGFIDWNYSIWDPGWYKINGD
GRFFRDWKKWGHGFVTLDTAIVQSCDTYFYELAHRMGVDRLHDFLSPFGFGHRTGIDMAG
EVSGVLPSTEWKRRTRKERWYPGESLNFGIGQGYMLSTPLQLAVATAIIANHGTIIEPRM
VEKISTKDTGIRPLEHAPLQHIKLRDPEQWRRMIASMRNVVMTKKGTAYGAVGRRLTEYD
MAGKTGTAQVVNIKQGETYQASKLKEWHRDHAWFMGFAPTDHPRIAVAVLVENGGHGGTD
AGPVAKQVIDAWFESDARSRSVTPEEQDASPATEALSTSQRMHTPPTGTEVAIH
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcaatgtaacttttcacgataaactccgcgaacaagggattttcaagcatcgc
cttgtggttgcattccttggcgtgctggcattggtcggcgtgctgctgttgcgtatgtat
catttacagatcgtccagtacagcacctacgaaaccatctccgatcgcaaccgcatccag
atcgaacccattgcccctacacgcggtttgatccttgatcgtaacggcacgattctggcc
gacaacaacccaacgttctccgttagcatcatcaaagagctggtgccgaacctaagccaa
accatcgccgatattcgggaactcattcccttgaacgataacgacgttcaacgctttgaa
aaacgcctgcaacagcgacgccgcccactcacacccatcgcgttacgtctaaacctcacc
gaagaagaaattgcaatcctctccgtacgcgcctacgacttgcccggcgtaatcatcgaa
gccaacctcgttcgccattacccgcagccagaactgctctcccataccatcggctatgtt
ggccgcatcaacgaggccgaactaaaacaggtagacgccaacaactacggcgcaaccgaa
tatatcggtaaaaccggcattgaaaaattctatgaagaccgcctccacggcaccgtcggc
tttcaaaaagtagaaaccgatgcgcgcggacgcaccactcgcgtactcgaaaaaatagat
cccaccggcggcgaaaaccttcacctctttctcgatttaccgacacaacaagccgcgcta
aaagcaatgaacggacggcgcggcgccgtagtcgccatcgagccagataccggcggcgtg
ctagcttttttgagcacccccggttttaactccaacctgtttgtaaccgggattgaccac
aaatcctataacgatctgcaaaatgaccgttggcgccccctatttaaccgcgctttacag
ggccaatatccaccgggttctaccgtaaaaccgatggtcggcttggccggacttgacggc
ggatttattgactggaattattccatttgggatccgggctggtacaaaatcaacggcgat
ggccgcttttttcgcgactggaaaaaatggggccacggctttgtaacgcttgacacggca
atcgtgcaatcatgcgacacctatttttatgaactcgcccaccgcatgggcgtagatcgc
ctccacgattttctctcgccattcggttttggccatcgcaccggaatcgacatggcaggc
gaggtgtccggtgtattgcccagcacagaatggaagcgccgcacgcgcaaagaacgctgg
tatccgggcgaatcactgaactttggcatcggccaaggctacatgttatcgacgcccttg
cagctcgccgttgcgacggcaatcatcgccaaccacggcacgattatcgaaccgcgcatg
gttgagaaaatcagcaccaaagacactggcatccgcccccttgaacacgcccctttgcag
cacattaagctacgagatcccgaacaatggcgcagaatgatcgcgtccatgcgcaacgtc
gtcatgaccaagaaaggcaccgcctacggtgccgtaggccggcggctgaccgaatacgat
atggcagggaaaaccggaaccgcgcaagtcgtgaatatcaaacagggcgagacctaccaa
gcctcaaaactcaaggaatggcaccgtgaccatgcgtggtttatgggctttgcgcccacc
gaccacccacgtattgccgtcgcagtattagtagagaacggcggtcacggcggtacagat
gccggccccgtcgccaaacaggtcattgacgcttggttcgagtcagacgcgcgcagtcgt
agcgtcacccccgaggagcaggatgcatccccggccacggaagcactttccacctcgcaa
cggatgcacaccccgcccaccggcaccgaggtcgcaatccattga

DBGET integrated database retrieval system