KEGG   Gamma proteobacterium HdN1: HDN1F_04960Help
Entry
HDN1F_04960       CDS       T01300                                 

Gene name
sodC
Definition
(GenBank) predicted Cu/Zn superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
gpb  Gamma proteobacterium HdN1
Brite
Enzymes [BR:gpb01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     HDN1F_04960 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: CBL44079
UniProt: E1VGY7
LinkDB All DBs
Position
complement(604166..604678)
Genome map
AA seq 170 aa AA seqDB search
MNKTIIFASILISSSAFASADVTMNTVNEKGVGASIGTVALSDSKFGLVLTPKLHGLPPG
LHGFHVHQNPSCAAQEKDGVMTPALAAGGHLDPSASNKHGEPWGDGHLGDLPPIYVDASG
NASQPVLAPRLKAADLVGHSLMIHAGGDNHADHPAPLGGGAGRIACGVVK
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaacaataatttttgcctcaattttaatctcttcatcagccttcgccagcgca
gatgtcaccatgaatacggtaaatgagaaaggcgtgggtgcatctattggaacagtggcc
ttgtcagactccaagttcggtttggttctaacgccaaagctgcatggactccctcccggt
ctccatgggtttcatgtgcatcagaacccaagctgtgctgcgcaagaaaaagatggagtg
atgactccagcacttgctgccggcggacatttggacccaagcgcttcaaataagcatggc
gaaccgtggggagatggccatttgggtgacctcccaccgatctacgtcgacgcatccggg
aatgcgtcgcagccggtgttggcgccgcgccttaaggctgcggacttggtggggcactcg
ctcatgatacatgccggtggcgataaccacgcagatcacccagcaccactaggcggtggt
gccggccgcattgcgtgcggcgtagtcaaataa

DBGET integrated database retrieval system