KEGG   Gamma proteobacterium HdN1: HDN1F_05860
Entry
HDN1F_05860       CDS       T01300                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
gpb00020  Citrate cycle (TCA cycle)
gpb00190  Oxidative phosphorylation
gpb00650  Butanoate metabolism
gpb01100  Metabolic pathways
gpb01110  Biosynthesis of secondary metabolites
gpb01120  Microbial metabolism in diverse environments
gpb01200  Carbon metabolism
Module
gpb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gpb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
gpb_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:gpb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HDN1F_05860 (sdhA)
   00650 Butanoate metabolism
    HDN1F_05860 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    HDN1F_05860 (sdhA)
Enzymes [BR:gpb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     HDN1F_05860 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     HDN1F_05860 (sdhA)
SSDB
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA DAO FAD_binding_3 HI0933_like Thi4 Pyr_redox_3
Other DBs
NCBI-ProteinID: CBL44169
UniProt: E1VH77
LinkDB
Position
730989..732761
AA seq 590 aa
MTSIRTMTYDAIIIGGGGAGMRAALQLSQSGYRTACITKVFPTRSHTVSAQGGITCAIAS
NDPNDDWRWHMYDTVKGSDYIGDQDAIEYMCSVGPEAVFELEHMGLPFSRTEAGRIYQRP
FGGQSKGPDNPTQAARTCAAADRTGHALLHTLYQNNLKNKTTFLIEWYAVDLVKNQDGAV
VGVIAINIETGETVFIQSQATVLATGGAGRIFSSTTNALINTGDGIGMALRAGFPVQDIE
MWQFHPTGIAGAGVLVTEGCRGEGGYLINAQGERFMERYAPNAKDLASRDVVARAMVKEI
LAGNGCGPEKDHVMLKLDHLGEEVLHKRLPGICELSKTFAHVDPVTAPIPVVPTCHYMMG
GVPTNIHGQAIAQDANGNDRIIDGLFAVGEVACVSVHGANRLGGNSLLDLVVFGRAAGLH
LEHALKEGIEHRPASQSDLDASFSRLNSLNTRTKGEPVAKLRKELQQCMQNYFGVFRTGE
FMEKGIKVLADLRDRVENVAITDKSQAFNTDRIEALELQNLFEVAEATAIAADERKESRG
AHAREDYEERDDKNWLCHSMYFPGEKRVSKRAVNFAPKTVPTFEPKKRTY
NT seq 1773 nt   +upstreamnt  +downstreamnt
atgactagcattcgtacaatgacttatgacgccatcatcattggtggcggcggcgccggc
atgcgcgctgcactgcaactttcgcaatccggctacagaaccgcctgcatcaccaaggtg
ttcccgacgcgttcgcacaccgtatcggctcagggtgggattacctgcgcaatcgcctcc
aacgatccaaacgatgactggcgctggcacatgtacgacaccgtcaaaggctccgactac
atcggtgaccaagacgcaatcgaatacatgtgttccgtaggcccagaagcagtgtttgag
cttgaacacatgggtttgccattctcacgcaccgaagcgggccggatttatcaacgcccc
tttggtggccagtccaagggcccagacaaccccacgcaagcggctcgtacctgtgccgcc
gctgaccgtaccggccacgcgctgctgcacaccctgtaccagaacaacctgaagaacaaa
accaccttcttgattgagtggtatgcggttgatctggtaaaaaaccaagacggtgccgtt
gtgggcgtgatcgccatcaacatcgaaaccggcgaaaccgtattcatccaatcgcaagcc
accgtcctcgccaccggcggcgctggccgcatcttctcctctaccaccaacgccttgatc
aatacgggtgatgggatcggcatggcgctgcgcgcaggcttccctgtgcaggatatcgaa
atgtggcaattccaccccaccggtatcgccggcgcgggcgtgctcgtcactgaaggctgc
cgtggtgaaggcggctacctgatcaacgcccaaggcgagcgcttcatggaacgctatgcg
cccaacgcgaaagaccttgccagccgcgacgtcgttgcacgcgcaatggtcaaagagatc
ctcgctggcaacggttgcggccctgaaaaagatcacgtaatgctcaaactcgaccatttg
ggcgaagaagtactgcacaagcgtttgccagggatttgtgagctctccaaaactttcgcg
catgtcgatcccgttaccgcgccgatcccagtcgtgcctacctgccactatatgatgggc
ggcgtcccgaccaacatccacggccaagccattgcgcaggacgcaaacggcaacgacaga
atcatcgacggtctgtttgccgtaggcgaagtcgcttgcgtatccgtacatggcgcaaac
cgcttgggcggtaactcgctgctcgacctcgtcgtgttcggccgcgcagccggtttgcac
cttgagcatgctctcaaggaaggcattgagcatcgcccagcgagtcaaagcgacctagat
gcatcgttctcgcgcttgaatagcctgaacacccgcaccaagggcgagcctgttgccaaa
ctgcgtaaagagctgcagcagtgcatgcagaactactttggcgtattccgcaccggcgaa
ttcatggaaaaaggcatcaaagtgctggcggacctgcgtgatcgcgtcgaaaacgtcgcc
attaccgataagagccaagcattcaataccgatcgcattgaagcgctggaactgcaaaac
ctgtttgaagtggcggaagccacagcgattgccgccgacgagcgcaaagaatcacgcggc
gcccacgcccgcgaagattacgaggagcgcgacgacaagaactggttgtgccactccatg
tactttcctggggaaaaacgcgtatccaaacgggcggtcaacttcgcaccgaaaaccgtt
cctacgtttgaacccaaaaaacgcacgtattaa

DBGET integrated database retrieval system