KEGG   Gamma proteobacterium HdN1: HDN1F_05870Help
Entry
HDN1F_05870       CDS       T01300                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase, iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
gpb00020  Citrate cycle (TCA cycle)
gpb00190  Oxidative phosphorylation
gpb00650  Butanoate metabolism
gpb01100  Metabolic pathways
gpb01110  Biosynthesis of secondary metabolites
gpb01120  Microbial metabolism in diverse environments
gpb01130  Biosynthesis of antibiotics
gpb01200  Carbon metabolism
Module
gpb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gpb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
gpb_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:gpb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HDN1F_05870 (sdhB)
   00650 Butanoate metabolism
    HDN1F_05870 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    HDN1F_05870 (sdhB)
Enzymes [BR:gpb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     HDN1F_05870 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     HDN1F_05870 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4_18
Motif
Other DBs
NCBI-ProteinID: CBL44170
UniProt: E1VH78
LinkDB All DBs
Position
732773..733492
Genome map
AA seq 239 aa AA seqDB search
MFLGKTLKVSVYRYNPEKDQAPYLQDFTVEINGKDMMVLDVLNLIKEQDTSLAYRRSCRE
GVCGSDGMNMAGKNGLACITPISQAIRDNKLVIHPLPGLPVIRDLVVDMNQFYTQYEKVK
PWLQNDQPAPAIERLQTPEQREKLDELYECILCACCSSGCPSFWWNPDKFLGPAALLQAY
RFLSDSRDTHTAERLAALDDPFSLFRCRGIMNCTHVCPKGLNPARAIGHIRTMLFDRGV
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttggcaaaactctcaaagtcagcgtatatcgctacaacccggaaaaggatcag
gctccctacctgcaagactttaccgttgaaatcaacggcaaagacatgatggtgctggac
gtcctgaacctgatcaaagagcaggacacttcacttgcctatcgccgctcctgccgcgaa
ggcgtgtgcggttccgacggtatgaacatggccggcaagaatggcttggcttgcatcacg
ccgatttctcaagcgatccgcgacaacaaactggtcatccatccgctgcctggcctgccg
gtgatccgcgacctcgtagtagacatgaaccagttctacacacagtacgagaaagtgaag
ccatggctgcaaaatgaccagccagcgcccgcaatcgagcgtctgcaaacgcccgaacag
cgcgaaaaactcgatgaactctatgagtgcatcctgtgcgcctgctgctccagcggctgc
ccgtcgttctggtggaaccccgacaagtttctcggccctgcagcgctcctgcaggcttac
cgcttcctgtcggatagccgcgatacccacaccgcagagcgattggccgcgctggacgat
ccgttcagcctgttccgctgccgtggcatcatgaactgcacccacgtttgccccaaaggt
ctgaaccctgcacgtgcgattggccacattcgcaccatgctgttcgatcgcggcgtgtaa

DBGET integrated database retrieval system