KEGG   Gamma proteobacterium HdN1: HDN1F_09670Help
Entry
HDN1F_09670       CDS       T01300                                 

Gene name
gst
Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
gpb00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:gpb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    HDN1F_09670 (gst)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gpb02000]
    HDN1F_09670 (gst)
Enzymes [BR:gpb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     HDN1F_09670 (gst)
Transporters [BR:gpb02000]
 Other Transporters
  Pores ion channels [TC:1]
   HDN1F_09670 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_N GST_C_2 GST_N_3 GST_N_2 GST_C_6 GST_N_5
Motif
Other DBs
NCBI-ProteinID: CBL44550
UniProt: E1VIA8
LinkDB All DBs
Position
1190557..1191153
Genome map
AA seq 198 aa AA seqDB search
MKLYYSPGACSLSPLIALHEAGIKVELIKVDLRSKAMANGGNYLDINPNGFVPALQLDSG
EILTEGPAIVQYIADLAPNSHIAPPNGTLDRVHLQEALNFVSSEVHKGFSPLFHPALPAE
WKAIVLDKLSQRFDYLAKRLEKSEWLVGKQFTVADGYLFTVLGWTVPCGIDLSRWPALVA
YRARIAERPKVKEAIAAQ
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctattactcccccggcgcctgctctttatccccattgattgcgctgcacgaa
gcaggcatcaaggtggagttgattaaggtggatctaagaagcaaagcaatggcaaatggc
ggcaattatcttgatatcaacccaaacggctttgtaccggccttacagcttgatagcgga
gaaattcttaccgagggccctgcgatcgtccaatacatcgcggatcttgcgccaaacagc
cacattgcgcctccgaacggtaccctggatcgcgtgcacttacaggaagcgttaaacttc
gtatccagcgaagttcacaaaggtttttcgccattatttcaccccgctttgcctgctgag
tggaaagccatcgtgcttgataagctgagccagcgctttgattaccttgcaaagcgtctg
gaaaaatcggagtggttggtaggcaagcagtttacggtagcagatggctacttgttcacg
gtattaggctggacggtaccttgtgggattgacttgagccgctggcccgcgctcgttgcc
taccgtgctcgcattgctgagcgccccaaggttaaagaagcgatcgcagcgcaataa

DBGET integrated database retrieval system