KEGG   Gamma proteobacterium HdN1: HDN1F_13080Help
Entry
HDN1F_13080       CDS       T01300                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
gpb  Gamma proteobacterium HdN1
Brite
KEGG Orthology (KO) [BR:gpb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HDN1F_13080 (ahpF)
Enzymes [BR:gpb01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     HDN1F_13080 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored DAO K_oxygenase FAD_binding_3 NAD_binding_8 Thi4 Glutaredoxin AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: CBL44891
UniProt: E1VJ99
LinkDB All DBs
Position
1625505..1627070
Genome map
AA seq 521 aa AA seqDB search
MLEASLKGQLKTYFEHVVHPIELVASLDDRDSSREMLELLTEIAELSEKVTLREQRDDQE
RKPSFSVNRVGANMGIRFAGIPMGHEFTSLVLALLQAGGHPPKIEPEIVEQIKSLEGEFR
FETYISLSCQNCPDVVQALNVMAVLNPNIRHTMVDGGLFQEEVAALEIMGVPAVYLNGKP
FANGRKTLEEIIAKLDTGAVARDAAKMDAKEAFDVLVVGGGPAGAAAAVYAARKGIRTGV
AAERFGGQVLDTLSIENFISVLETEGPRMAAALEAHVRHYNVDIMNLQTATKLIPASESS
DGLVHVEFESGATLRSKSVVLSTGARWRNMNVPGEAEYRTKGVAYCPHCDGPLFKGKSVA
VIGGGNSGVEAAIDLAGIVEHVTVIEFDDKLRADGVLQKKLHSMPNVKVILSALTTEVTG
DGQKMDGLVYTDRSTGESHRLDLAGVFVQIGLVPNTDWLKGTVELSNRGEIVVDDRGHTS
VPGVFAAGDCTTVPYKQIVIAMGEGAKASLTAFDYLIRTSV
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaagcttcccttaaaggtcagttgaaaacctattttgaacatgtggtgcacccg
attgaattggttgcatccttggatgatcgtgacagcagccgtgaaatgctggaactgctc
accgagattgccgaactgtcggagaaagtaacgctgcgtgagcagcgcgatgaccaagag
cgtaagccgtcgttcagcgtcaatcgcgtgggtgccaatatgggcatccgctttgccgga
attccgatggggcatgagtttacctcgctggtccttgcactgctgcaagccggtgggcat
ccaccgaaaattgagcccgaaatcgttgaacagattaagtcgctggaaggcgagtttcgg
tttgaaacctatatttccctaagctgccagaactgcccagatgtggttcaagcgctcaac
gtaatggccgtcctcaacccgaatatccgccacaccatggtggatggcggtttgttccaa
gaggaagttgccgcccttgaaattatgggcgttccggcggtgtatctaaacggcaagccg
tttgcaaatgggcgcaaaacgctggaagaaattattgccaagctggatacgggcgcggtt
gcgcgcgatgctgccaaaatggatgcaaaggaagcatttgatgtgctggtcgtgggaggt
ggccccgccggtgctgcggcggcagtgtatgctgcgcgtaaaggtattcgcaccggagtt
gcggcggaacgttttggcggccaagtgttggataccctgtcgattgagaactttatctcg
gtattggaaaccgaggggccaagaatggcggcggcattagaagcgcatgttcgccattac
aatgtggatatcatgaatttacaaactgccaccaaattgattcctgcgagtgagtcaagc
gatggcttggtgcacgttgagtttgaaagcggcgcaactttgcgtagcaagagtgtagtg
ctttcaacgggcgctcgttggcgcaatatgaacgtgcctggcgaagccgagtaccgcacc
aagggcgttgcatattgtccacactgcgatggcccgctatttaagggcaagagcgttgca
gtgatcggcggcggaaattcgggcgtcgaagcagccattgacttggcaggaatcgttgag
cacgtcaccgtaattgagtttgacgacaagctgcgtgcagacggggtgttacagaaaaag
ctgcatagcatgccgaacgtaaaagtcatcctctccgcgctaacgacggaagtcactggc
gatggtcagaaaatggatggtttggtctataccgatcgctcgacgggcgaatcgcatcgc
ttggatcttgccggcgtgttcgtgcagatcgggcttgtgccgaacacggattggctcaag
ggtacggtagaactgagcaatcggggtgagattgtagtcgatgatcgtggccatacttct
gtgccgggagtgtttgccgctggtgactgtacgactgtgccgtataagcagatcgttatt
gcgatgggtgagggcgcaaaagcctcgctaacggcgtttgattatctgattcgcacgtcc
gtttaa

DBGET integrated database retrieval system