KEGG   Gamma proteobacterium HdN1: HDN1F_22530Help
Entry
HDN1F_22530       CDS       T01300                                 

Definition
(GenBank) Uracil-DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
gpb03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:gpb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    HDN1F_22530
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:gpb03400]
    HDN1F_22530
Enzymes [BR:gpb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     HDN1F_22530
DNA repair and recombination proteins [BR:gpb03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     HDN1F_22530
 Prokaryotic type
     HDN1F_22530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: CBL45836
UniProt: E1VLZ4
LinkDB All DBs
Position
2787305..2788069
Genome map
AA seq 254 aa AA seqDB search
MDRGRWLVTGSQSDFVEATAAASTDASSRIRLEGSWKQFLISEFEQPYMKGLRDFLNAEK
QAGKSIYPRGSEYFQALNSTPFEEVKVVVLGQDPYHGPGQAHGLSFSVLPGTPFPPSLIN
IFKELQTDVGVPVPAHGCLSHWAEQGVLLLNSVLTVEAGKAGSHQGRGWEIFTDRIVREL
ASQREGLVFLLWGSYAHKKGQFIDRKRHLVLSAVHPSPLSAYRGFFGCKHFSQTNAFLLA
HGKKPIDWTVSPRS
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
gtggatcgtggtaggtggcttgtgacaggttcgcagagcgattttgtagaggctacagct
gcggcatcaacggatgcatcttctcgaattcgcttggaggggagctggaagcagtttctg
attagcgagtttgagcaaccctatatgaaggggctgcgggattttttgaacgccgaaaag
caggccggaaagagcatttatcctcgcggtagtgagtattttcaggcacttaacagcacg
ccttttgaggaggtcaaagttgtggtgctcggtcaagatccttaccatgggccagggcag
gcgcatggtctctccttctctgttttacctggtacgccattcccgccttcgctgatcaat
attttcaaggagctgcagacggatgtgggagtaccggtgcccgctcacggttgcctgagc
cattgggcggaacaaggcgttttgctgctcaacagcgtgttaaccgtggaagcggggaag
gccggttcacaccaagggcgtggctgggaaatttttaccgaccgtatcgtgcgcgagctg
gcctcacagcgggaaggtttggtgtttctgttgtggggtagttatgcccacaagaagggc
caattcattgatcggaaaagacatcttgttctctctgcggttcatccgtcgccattgtcg
gcctatcgtggcttttttgggtgtaaacatttcagtcaaacaaatgcttttttgctggct
cacggtaagaaaccgattgactggacagtatcgccaagatcatga

DBGET integrated database retrieval system