KEGG   Gamma proteobacterium HdN1: HDN1F_28410Help
Entry
HDN1F_28410       CDS       T01300                                 

Gene name
fabA2
Definition
(GenBank) 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
gpb00061  Fatty acid biosynthesis
gpb01100  Metabolic pathways
gpb01212  Fatty acid metabolism
Module
gpb_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:gpb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    HDN1F_28410 (fabA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:gpb01004]
    HDN1F_28410 (fabA2)
Enzymes [BR:gpb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     HDN1F_28410 (fabA2)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     HDN1F_28410 (fabA2)
Lipid biosynthesis proteins [BR:gpb01004]
 Fatty acid synthase
  Component type
   HDN1F_28410 (fabA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: CBL46424
UniProt: E1VNN2
LinkDB All DBs
Position
complement(3495758..3496273)
Genome map
AA seq 171 aa AA seqDB search
MNQKNAYNLEELLECSHGRMFGPGNAQLPLPNMLMLDRIALITDTGGKYDKGEIIAELDV
HPDLWFFACHFEGDPVMPGCLGLDAMWQLIGFYLGWRGNKGRGRALGVGEVKFFGQVLPK
AKKVTYRIDMKRVIERKLVMGIGDASLLVDDREIYTATDLRVGLFTSTDSF
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaaaaaacgcctacaacctagaagaattgcttgaatgttcacacggacggatg
ttcggcccaggcaacgcccagctcccacttcccaatatgttgatgctagatcgcatcgca
ttgattaccgatactggcggcaagtacgataaaggtgagattatcgccgagctcgacgta
catcctgatctttggtttttcgcctgccactttgaaggcgaccccgtaatgccgggctgc
ctcggccttgacgccatgtggcagttgattggcttttaccttggctggcgcggcaacaaa
ggccgcggtcgcgccttgggcgttggcgaagtcaaatttttcggccaagtgctcccaaaa
gccaaaaaagtcacctaccgcattgacatgaaacgcgtaattgagcgcaaactggtcatg
ggcattggcgatgcgtcgcttttggtagatgatcgcgagatttacaccgccaccgatctg
cgtgtcgggctgttcacttccactgacagtttctaa

DBGET integrated database retrieval system