KEGG   Gamma proteobacterium HdN1: HDN1F_34290Help
Entry
HDN1F_34290       CDS       T01300                                 

Definition
(GenBank) Malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
gpb00020  Citrate cycle (TCA cycle)
gpb00270  Cysteine and methionine metabolism
gpb00620  Pyruvate metabolism
gpb00630  Glyoxylate and dicarboxylate metabolism
gpb00680  Methane metabolism
gpb01100  Metabolic pathways
gpb01110  Biosynthesis of secondary metabolites
gpb01120  Microbial metabolism in diverse environments
gpb01130  Biosynthesis of antibiotics
gpb01200  Carbon metabolism
Module
gpb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gpb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
gpb_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:gpb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HDN1F_34290
   00620 Pyruvate metabolism
    HDN1F_34290
   00630 Glyoxylate and dicarboxylate metabolism
    HDN1F_34290
  09102 Energy metabolism
   00680 Methane metabolism
    HDN1F_34290
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    HDN1F_34290
Enzymes [BR:gpb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     HDN1F_34290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: CBL47012
UniProt: E1VQC0
LinkDB All DBs
Position
complement(4164674..4165654)
Genome map
AA seq 326 aa AA seqDB search
MKKPVRVTVTGAAGQISYSLLFRIASGEMLGKDQPVILQMLEITPALKALNGVAMELDDC
AFPLLHGMVQTDNPSVAFKDTDYALLVGARPRGPGMERKDLLEANAAIFSVQGKAINDNA
SRDIKVLVVGNPANTNALIAQRNAKDINPRQFTAMMRLDHNRSLTQLAQQTGSSINDIRK
MVVWGNHSSTQYPDISKATVSGKAAEGLVEQAWYRETFIPTIQQRGAAIIQARGASSAAS
AANAAINHMRDWALGTPEGDWVSMGVYSDGSYGISEGLIYSFPCVCKDGNWDIVQGLEVS
DFSREKMKATEKELSEERDAVKHLLP
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacctgttcgagttaccgttactggcgcagcgggccagatcagctactcactt
ctgttccgcattgcatccggcgaaatgctgggcaaagatcagcccgtaatcctgcaaatg
ctggaaatcacgcctgctctcaaagcgctgaacggcgtggccatggaacttgatgattgc
gcattcccactgctgcacggtatggtgcaaacggacaacccaagcgtcgcgttcaaagat
accgactacgcactcctcgtaggtgcgcgtccacgcggccctggcatggagcgtaaagat
ctgctcgaagccaacgcagcgattttctcggtacaaggcaaggccatcaacgacaacgcc
agccgcgatattaaagtgctcgtggtaggcaaccctgccaacaccaacgcgctgatcgct
caacgtaacgcaaaagacatcaatccgcgccagttcaccgcgatgatgcgccttgatcat
aaccgttcgctgacccaactggcccagcaaaccggcagctccatcaacgacattcgcaaa
atggtcgtttggggcaaccactcctctacccaataccctgacatttccaaagccaccgtt
tccggcaaggcagccgagggtttggttgaacaggcttggtaccgtgaaaccttcattccc
accattcaacagcgcggtgcagcgatcattcaggcgcgtggcgcaagctctgctgcttct
gctgccaatgcggccatcaaccacatgcgcgattgggcgctgggcacgcccgagggcgat
tgggtgagcatgggcgtatacagcgacggctcatacggtatcagcgaaggcctgatctac
tccttcccctgcgtctgcaaagacggcaactgggacatcgtacaaggtcttgaagttagc
gatttcagccgcgaaaaaatgaaggcgactgagaaagagctgtctgaagagcgcgatgca
gtaaaacacctgctgccttga

DBGET integrated database retrieval system