KEGG   Gemmatimonas phototrophica: GEMMAAP_04565Help
Entry
GEMMAAP_04565     CDS       T04580                                 

Definition
(GenBank) hypothetical protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gph  Gemmatimonas phototrophica
Pathway
gph00010  Glycolysis / Gluconeogenesis
gph00020  Citrate cycle (TCA cycle)
gph00620  Pyruvate metabolism
gph01100  Metabolic pathways
gph01110  Biosynthesis of secondary metabolites
gph01120  Microbial metabolism in diverse environments
gph01130  Biosynthesis of antibiotics
gph01200  Carbon metabolism
Module
gph_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GEMMAAP_04565
   00020 Citrate cycle (TCA cycle)
    GEMMAAP_04565
   00620 Pyruvate metabolism
    GEMMAAP_04565
Enzymes [BR:gph01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     GEMMAAP_04565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 Phage_Gp19
Motif
Other DBs
NCBI-ProteinID: AMW06552
UniProt: A0A143BPQ0
LinkDB All DBs
Position
complement(1127637..1128941)
Genome map
AA seq 434 aa AA seqDB search
MEALSPTMEEGRLAKWTKNVGDVVKSGDTIAEVETDKAIMELVARGDGVLRARLIEEGAT
APVGNLIGVIAAADEDISAFGAGGGAAAAAPAAAAPAAAAPAAAAAAAPAPAPVAVAEQP
VGVHGGTESAESAAGPTRSSPLARRMAAEKGLSLSAIQGSGPGGRIIRRDIEAAASAAPV
AAQAAAAVTATSSASKPTATATAMQIDGEYKDVALTQMRKTIARRLGESIGPIPTFFLTS
EIDMTNVGKLREQMVAAGDQFKVSVNDIVIKAVAIALTRHPEVNAHWMGDSIRYFSAAHV
GMAVATDDGLIVPVIRDAHLKGLGAIGKEARELAKRARERKLQPAEFTGGTFSVSNLGMF
GIDQFTAIINPPEAAILAVGATETKPVWENGQFVPRQRMRVTMSCDHRIIDGAVGAKFLQ
TLRQLLEAPMMMLF
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgctttcccccacgatggaggaggggcgtctggcgaagtggaccaagaacgtc
ggcgacgtggtgaagtcgggcgacacgattgccgaggtcgagaccgacaaggcgatcatg
gagctcgtcgcgcgtggcgacggcgtgttgcgggcgcgtctcatcgaggaaggcgcgacg
gcaccggtcgggaacctcatcggcgtgattgcagcggccgacgaagacatttcggcattc
ggtgccggtggtggggctgcagcagcagcacctgcagcagcagcacctgcagcagcagcg
cctgcggcggctgccgccgcggctccggcgccggctccggtggcggtggcggaacagcct
gtgggagtgcacggggggacagagagcgcggagtcggcagcgggtccaacgcgatcgtct
cccttggcgcgtcgcatggccgccgagaaggggctgtcgctctcggccattcaaggcagc
ggccctggggggcgcatcattcgtcgtgacatcgaggccgcggcttcggcggcgcctgtt
gcggcacaagcggcagcggcggtcacggccaccagcagtgccagcaagcccaccgcgacg
gccaccgccatgcagatcgatggcgagtacaaggacgttgcactcacgcagatgcgcaaa
accatcgcgcgtcgcctcggcgagtccattggccccattcccaccttcttcctcacgtcg
gagatcgacatgacgaacgtgggcaagctgcgcgagcagatggtggccgcgggcgatcag
ttcaaggtgtcggtgaacgacatcgtgatcaaagcggtggccattgcgctcacgcggcac
cccgaagtgaacgcgcactggatgggcgattccattcgctacttcagcgccgcgcacgtg
ggcatggccgtggcaacggacgacggactcattgtccccgtcatccgcgatgcgcacctc
aagggtctgggagctatcggcaaggaagcgcgggaactggccaagcgggcgcgcgagcgc
aaactgcagccggccgagttcacgggcggcacgttcagcgtgtccaacctgggcatgttc
ggcatcgaccagttcaccgccatcatcaacccgcccgaagcggccatcctcgcggtgggc
gccacggaaacgaagccggtgtgggagaacgggcagtttgtcccgcgtcaacgcatgcgc
gtgaccatgagctgcgatcaccggatcattgatggcgcggtgggggcgaagttcctgcag
acgctgcggcagctgctggaagcgcccatgatgatgctgttctga

DBGET integrated database retrieval system