KEGG   Gemmatimonas phototrophica: GEMMAAP_14995Help
Entry
GEMMAAP_14995     CDS       T04580                                 

Gene name
fadJ
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
gph  Gemmatimonas phototrophica
Pathway
gph00071  Fatty acid degradation
gph00280  Valine, leucine and isoleucine degradation
gph00281  Geraniol degradation
gph00310  Lysine degradation
gph00362  Benzoate degradation
gph00380  Tryptophan metabolism
gph00410  beta-Alanine metabolism
gph00640  Propanoate metabolism
gph00650  Butanoate metabolism
gph00903  Limonene and pinene degradation
gph00930  Caprolactam degradation
gph01100  Metabolic pathways
gph01110  Biosynthesis of secondary metabolites
gph01120  Microbial metabolism in diverse environments
gph01130  Biosynthesis of antibiotics
gph01200  Carbon metabolism
gph01212  Fatty acid metabolism
Module
gph_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:gph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    GEMMAAP_14995 (fadJ)
   00650 Butanoate metabolism
    GEMMAAP_14995 (fadJ)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GEMMAAP_14995 (fadJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GEMMAAP_14995 (fadJ)
   00310 Lysine degradation
    GEMMAAP_14995 (fadJ)
   00380 Tryptophan metabolism
    GEMMAAP_14995 (fadJ)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GEMMAAP_14995 (fadJ)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    GEMMAAP_14995 (fadJ)
   00281 Geraniol degradation
    GEMMAAP_14995 (fadJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GEMMAAP_14995 (fadJ)
   00930 Caprolactam degradation
    GEMMAAP_14995 (fadJ)
Enzymes [BR:gph01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     GEMMAAP_14995 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     GEMMAAP_14995 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     GEMMAAP_14995 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 F420_oxidored NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AMW05752
UniProt: A0A143BML9
LinkDB All DBs
Position
complement(3563815..3565971)
Genome map
AA seq 718 aa AA seqDB search
MHVLFEDAETGLVLSVQDGVALISYDQPQSPVNTLNSRIGPVFEQCFARIERDPTIVGAV
LVSGKPDSWIAGADIEELTRITEASQGEALSRGGHALLNRLATMSKPMVAAIHGAALGGG
LEVALACRYRLATEHAKTMLALPEVQLGLIPGAGGTQRLPRTVGLQAALDMILTGKNIRA
RKAWQMGLVHELVHPSILRDIAVRRVRDLAAGRTPPSKARAQSATTMLLEDNALGRKVVF
KKARESVLAKTRGHYPAPLAAIDVIQLGYAEGMEAGLAEEARRFGALAVSPECRQLASLF
FATTALKKDSGLPDGVTATARAVKKIGVLGAGFMGAGIAGVAVQAGTQVRLKDASLERLA
AGWRSVRDLLRERLRKKQISRLQLDDTLSLIGGTTDYRGFANADIVIEAVFEDLAVKHQV
LREVEDAAPTAIFASNTSTIPIREIAAAATRPEQVLGMHFFSPVHKMPLLEVIVTPFTSA
ESTATAVQYGRQLGKTVIVVQDGAGFYVNRILAPYLNEAGRLLDDGARIEDVDSALTAFG
FPVGPITLLDEVGLDIAGKSGPIMAAAFGDRMLPSTTLQRVVESGRVGRKARKGFYRYSE
QGKREGVDESVYALTPAGGTRHTVLADEIQQRCVLPMLNEAVRCLQHGIIRNARDGDIGA
VFGIGFPPFLGGPFRHLDTLGASTVVQQLDALNTRFPGRFEPAAMLREMAATGRRFHP
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atgcacgtgttgttcgaagatgccgagacggggctggtactgagcgtgcaggatggcgtg
gcgctgatttcgtacgatcagccgcagtcgccggtcaatacgctcaactcccgcattggc
ccggtgttcgaacagtgctttgcccgcattgagcgtgaccccaccatcgtaggtgcggtg
ctggtgagcgggaagccggacagctggattgctggtgccgatatcgaggagctgacgcgc
attaccgaggccagtcagggagaagccttgtcgcgcggcggacatgcgctgctgaaccgc
ttggcgaccatgtcaaagccgatggtggctgccatccatggtgccgccctcggtggtgga
ctcgaagtggcgctggcctgtcgctatcgcctggccactgagcatgccaaaaccatgctg
gcgttgccggaagtgcaactgggactcattcccggagcagggggcacgcagcggttgccg
cgtaccgtggggctgcaggcggcgctcgacatgattctgaccggcaagaacatccgggcg
agaaaggcatggcagatgggactggtgcatgagttggtgcacccctccatcctgcgcgac
atcgcggttcgtcgcgtgcgtgatctggcggccggtcgaacgccaccgtccaaggcgcgg
gcgcaaagcgccaccaccatgctgctcgaagacaacgcactcgggcgcaaggtggtgttc
aaaaaagcgcgcgaaagtgtgctcgccaaaacgcgcggtcattatccggcccccttggcc
gccatcgacgtcatacagttgggttatgccgaagggatggaggcagggctggcggaagag
gcacgtcgctttggtgccctcgcggtttcaccggagtgccgacagctcgcttcgctgttc
tttgcgaccacggcgctcaagaaggatagcgggctccccgatggcgtaacggccacggcg
cgcgccgtgaagaagatcggcgtactgggtgcaggcttcatgggagcgggcattgccggt
gtggcggtgcaggctggcacgcaggtgcgcctcaaagacgcgtcgctggagcggctggcc
gcaggatggcgctcggtgcgcgatctgctgcgcgaacggctgcggaaaaagcagatctcg
cgcttgcagctggacgacacgctctccctgattggtgggacgaccgactatcgcgggttc
gccaacgcggacatcgtgatcgaggcggtgtttgaagatctggcggtgaagcaccaggtg
ctccgtgaagtggaggacgcggcgcccacagccatctttgcgtccaacaccagcaccatc
cccattcgcgagattgccgcggcagcgacgcgccccgagcaggtgctcggcatgcacttc
ttctcgccggtgcacaagatgccgctgctggaggttatcgtgaccccattcaccagcgcc
gagtccaccgccaccgcggtgcagtatgggcggcagctggggaagaccgtcattgtggtg
caggatggcgcgggcttttacgtgaatcgcattctggcgccgtatctcaacgaggccggc
cggttgctggacgacggggcccggattgaggatgtcgatagcgcactgacggcgttcgga
tttccggtggggcccatcacgctgctcgacgaagtggggctggatattgccggcaaatcg
gggcccatcatggctgctgcgtttggcgatcgcatgttgccgtccaccacactgcagcgg
gtggtggagagtggccgggtggggcgaaaagcgcggaaggggttctatcgctacagcgag
cagggcaagcgcgagggggtggacgagtcggtgtatgctctcacgccggccggcggcacg
cgacatacggtgctggccgatgagatccagcaacggtgtgtactccccatgctcaacgaa
gccgtgcggtgcctgcagcacggcatcattcgcaatgcgcgtgacggtgacatcggcgcg
gtgttcggcattggcttccctccgtttctcgggggacccttccggcaccttgatacactc
ggcgcctcaacggtggtgcagcagctcgacgccctgaatacccgcttccctggccgcttt
gaaccagcggcgatgttgcgcgagatggcagcaacggggcggcggtttcatccgtag

DBGET integrated database retrieval system