KEGG   Gemmatimonas phototrophica: GEMMAAP_15005Help
Entry
GEMMAAP_15005     CDS       T04580                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
gph  Gemmatimonas phototrophica
Pathway
gph00564  Glycerophospholipid metabolism
gph01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gph00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    GEMMAAP_15005
Enzymes [BR:gph01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     GEMMAAP_15005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_oxidored Pyr_redox_2 FAD_binding_2 GIDA NAD_binding_8 3HCDH_N Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AMW05754
UniProt: A0A143BMU4
LinkDB All DBs
Position
3567323..3568987
Genome map
AA seq 554 aa AA seqDB search
MSISPETADRRASLTRLADDLFDVLVIGGGITGAGVAREAALAGYRTALVERDDFAAGTS
SRSSRLVHGGVRYLEHGHLGLVFESSHERRLLLQLAPHLVRPLAFTWPVYRGARVPRWKV
RAGLLLYDALALFRNVQAHEGLNAAEVLEREPALTSEGLTGGARYWDAATNDTRLTLATA
LGAAASGAVLANHCAVEGAVHSANGRLAGVTVRDVLTDTTFAVRARVVVNATGPWSEATA
ALTGESQGTQVLGSAGTHIAVPRQRIGNHDAITMVSPLDGRVMFVLPSGPHAIVGTTEQP
ARRGPDEIRATETDVTYLLQSVNRMFPHAALTPDDVISAWCGIRPLAMTRAGAHSANSAS
REHAVLHRADGLVSVTGGKLTTYRAMAADVLAQARREFATSGSAPVPIHAPLPSASTPLP
GGAFASRDALIAEARAATQDHAVAEHLVHAHGTQWQKVWRSTHHTSTDAGRLVETLPYTW
AEVRYTVQHELACTLSDVLIRRTHVAFETRDHGRGAAERIAPLMASLLGWSDEERVAAVA
RYHADVTRLFAIDA
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcagccctgagactgctgaccgccgcgcgtcactcacccggttggcagacgac
ctgtttgatgtgctggtgattgggggcggcatcaccggggccggtgttgcccgtgaagcg
gcgcttgccggctatcggacggcactcgtggaacgtgacgattttgcggccggcacctcc
agccgctcctcccgcctggtgcatggtggcgtccggtacctcgagcatgggcacctgggg
ctggttttcgaatccagccatgagcgccgactgctcctgcagttggcaccgcaccttgtg
cgcccgctcgcgttcacctggccggtgtaccggggcgcgcgcgtgccgcggtggaaagta
cgcgcggggctgctgttgtacgacgcgttggcgctcttccggaatgtgcaggcgcatgag
ggactgaacgccgccgaggtgctggagcgcgaaccggcgctgacgagtgaggggctcacc
ggcggggctcgctactgggacgcggccaccaacgatacacgactcacactggccaccgcg
ctcggtgccgcggcctctggcgcggtgctggcgaatcactgcgccgtggaaggggcggtg
cactcggcgaatggccgtttggccggcgtgacggtgcgcgatgtgctcactgacaccacc
tttgccgtgcgcgcccgggtggtggtgaacgccaccggaccgtggagcgaggccactgcg
gccctcactggcgagagccagggaacgcaagttcttggctcggccgggacacacattgcg
gtcccccgccagcggatcggcaatcacgacgcgatcaccatggtctcgccactggatggg
cgcgtgatgttcgtcctgccctcggggccgcacgccattgtcggcaccacggaacagccg
gcgcgccgcgggcccgacgaaatcagggctaccgagaccgacgtcacctacctgcttcag
tcggtgaaccggatgtttccccatgcggctctcacccccgatgacgtaatcagtgcgtgg
tgtggcatccgcccgctcgcgatgactcgcgcgggtgcgcactctgccaactcggcctct
cgtgaacacgcggtcctccatcgcgccgatggcctggtgagcgtcacgggtggcaaactg
accacgtaccgggcaatggccgccgacgtgctcgcgcaggcccgccgtgaatttgcgacc
agtggcagcgcccccgttcccatccacgcgccactccccagtgcgtccacaccgctaccc
ggtggcgcgtttgcctcgcgtgacgcgctgatcgccgaggcacgggccgccacgcaagac
cacgcggtggctgaacatctcgtgcatgcccatggcacccagtggcagaaggtctggcgg
tccacgcaccacaccagcacagacgccggacgtctcgtggagacgctcccctacacgtgg
gccgaagtgcggtacacggtgcagcacgaactggcctgcacgctttcggatgtgctgatc
cgccggacccacgtggcgttcgaaacacgcgaccacggacgtggcgcggcggaacgcatt
gcgccactcatggcgtcgctactgggctggagcgacgaagaacgcgtcgccgcggtagcg
cgctatcacgccgacgtcacccgactgtttgcgattgacgcctga

DBGET integrated database retrieval system