KEGG   Gemmatimonas phototrophica: GEMMAAP_18240Help
Entry
GEMMAAP_18240     CDS       T04580                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
gph  Gemmatimonas phototrophica
Pathway
gph00620  Pyruvate metabolism
gph00680  Methane metabolism
gph01100  Metabolic pathways
gph01120  Microbial metabolism in diverse environments
gph01200  Carbon metabolism
Module
gph_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:gph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GEMMAAP_18240
  09102 Energy metabolism
   00680 Methane metabolism
    GEMMAAP_18240
Enzymes [BR:gph01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     GEMMAAP_18240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: AMW06201
UniProt: A0A143BP16
LinkDB All DBs
Position
complement(4346322..4349105)
Genome map
AA seq 927 aa AA seqDB search
MTTNRDDKDLPLRDDIRLLGRLLGDAVRDQEGEATFDLVEQTRQAAVRFAREGRAEDRAR
LHALLDTLPPATMLSVVRAFAYFLQLANIAEDTHRARRRRSHEAMGSPPREGTLAFALDA
VRAAIGNDAVARERLQQFFAEALIAPVLTAHPTEVQRQSTQVAMQQVADLLERRDRMVLT
AEEQAESDIALQRQVLTLWHTRLVRGERLRVIDEVKNGIGYYRSTFFTEVPRLYANTAAL
LHERFPGADFPLGTFLRVGSWIGGDRDGNPFVTADILRDTLRLQAAAAFDFYLEEVHALG
GMLSISRTLHSITPELDALAANSPDKSVQRLDEPYRRALSGVYARLVATMRRLELPPPTR
AALGEGVPYAEAVELRADLQVVRDALVRTQLPLLASGRLQRLLTAVEVFGFHLAPLDLRQ
NADVHEQVVAELLAQAGVCANYLALTEEARVALLAAELAGTRPVYSPHLVYSEDVQRELD
IVFAARAMRERYGHSALPHYIISKCDGVSDLLEVALMLKEAGLATGGAAPSLGLDIIPLF
ETISDLQRAGTTMSAAFALPIYRALVQSRGDVQEVMLGYSDSNKDGGFLTSGWELYQAEL
ALMTVFTSAGVKLRFFHGRGGSVGRGGGPSYDAILAQPSGAVSGQIRLTEQGEVIASKYA
TPDVGRRNLELLVAATLEATLTDHENQADKAVTFHPVMDRLSALAFRAYRALVYETPGFT
QYFRESTPLAEIATLNIGSRPASRKPSDRIEDLRAIPWVFAWAQCRCMLPGWYGFGTAVA
QWLQETPDGLPVLQRMATRWPFFRTLLSNVDMVLAKSDLRVASRYSELVSDDALRGQIFG
AIEAEWQRTREALRLITGEEQLLADNPLLARSIANRFPYMDPLNHLQIALLKRHRDLLAA
GGNVDEHVRRGIHLTINGIAAGLRNSG
NT seq 2784 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgaaccgcgacgacaaggatcttccgctccgcgatgacatccgcctgctgggc
cgtttgcttggcgatgcggtgcgcgatcaggagggggaggccacgttcgacctggtggag
cagacgcgtcaggccgccgtgcgctttgcgcgtgaggggcgggcggaagaccgcgcgcgg
ctgcacgcgctgctcgatacgctgccaccggccaccatgctcagtgtggtgcgggccttc
gcctattttctgcagctggccaacattgcggaagacacgcatcgggcacggcggcggcgc
tcgcacgaagccatggggtcaccgccgcgcgaggggacactggcctttgcgctcgatgcc
gtgcgtgcggccattggcaacgacgccgtcgcacgcgagcggctgcagcagttcttcgcc
gaggcgctcattgcaccggtgctcacggcgcaccctaccgaggtgcagcggcagagtaca
caggtggccatgcagcaggtggccgacctgttggaacgccgggatcgtatggtcctgacg
gcggaagagcaggcggaaagtgacattgcgctgcagcgtcaggtgctcacgttatggcac
acgcggctggtgcgtggcgagcggctgcgagtgattgatgaggtgaagaacgggattggg
tactaccgcagcacgttcttcacggaggtgccacgtctctatgccaacacggcagcgctg
ttgcacgagcgctttcccggggcggattttccgctggggaccttcctgcgtgtgggcagt
tggattggcggcgaccgtgacggcaatccgttcgttaccgctgatattctgcgcgacacg
ttgcgattgcaggcggccgccgcgttcgacttttatctggaagaagtgcacgcgctgggt
ggtatgctcagtatctcgcgtacgttgcacagcattacgccggagctggacgcgctggcc
gcgaattccccggacaagtcggtgcagcgtctcgatgagccgtatcgtcgcgcgttgagc
ggcgtgtacgcgcgtctggtggccaccatgcgccgactcgagctgccgccacccacgcgg
gcggcgttgggagaaggggttccgtacgctgaggcggtcgagctacgcgccgatctacag
gtggtgcgggacgccttggtgcgtacccagttgccgctgctggccagtggacgtctgcag
cggctgcttacggccgtggaggtgttcggcttccatctcgcgccactcgacctgcgccag
aacgcggatgtgcacgagcaggtagtcgccgagctgctggcgcaggccggcgtgtgcgcc
aactatctcgccttgaccgaagaggcgcgggtggcactgctggccgccgagctcgcgggc
acccgtccggtgtattccccgcatttggtgtacagcgaagatgtgcagcgcgaactggac
atcgtgtttgcagcacgcgccatgcgggagcgttacggacactcggccttgccgcactac
atcatttccaagtgcgacggcgtgtcggacttgctggaagtggcgctcatgctcaaggag
gcggggctggccaccggaggggcagcgccctcgctggggctcgatatcattcccctgttc
gagacgatcagcgacctgcagcgcgccggcacaaccatgagcgcggcgtttgcgctgccc
atctatcgtgcgctggtgcagtcgcgaggtgatgtgcaggaagtgatgctgggctattcg
gacagcaacaaggacggcggctttctcaccagtggctgggagctgtaccaggccgaactg
gccttgatgaccgtgtttaccagtgccggcgtaaagctgcgcttctttcacgggcgcggc
ggcagtgtggggcgtggtggtggccccagctacgacgccattctggcgcagccgtcgggg
gccgtgagtggccagatccgtctcaccgaacaaggcgaggtgattgcgtccaagtatgcc
acgcccgatgtcgggcgccgcaatctggagctgctggtggcggccacgttggaagccacg
ctcaccgatcacgagaatcaggcggacaaggcggtcacctttcacccggtcatggaccga
ttgtcggcgctcgcctttcgcgcctatcgcgccctcgtgtacgaaacgccggggttcacg
caatattttcgcgagagcacaccgctggcggaaattgccacgctcaacattggcagccgc
cccgcgtcgcgcaaaccgtcggaccgtattgaggacttgcgcgccattccctgggtgttt
gcgtgggcgcagtgtcgctgcatgctcccgggttggtatgggtttggcactgcagtcgcg
caatggctgcaggaaacacctgatggtcttccggtgctgcagcgtatggccacgcgctgg
ccgttcttccgcacgttgttgtcgaatgtggatatggtgctggccaagagtgacctgcgg
gtggcgtcgcgctattcagagctggtgagcgacgatgcgttgcgagggcagattttcggc
gccattgaagccgagtggcagcgcacgcgtgaggcgttgcggctcattaccggtgaggag
cagttgttggcggataatccgctgctggcgcgctccattgccaaccgctttccctatatg
gacccgctcaatcacctgcagattgccctgctcaagcggcatcgcgatttgctggcggca
gggggcaacgtggatgaacatgtccgccgcggcattcatctgacgattaacggcatcgcg
gccgggctgcgcaatagcgggtga

DBGET integrated database retrieval system