KEGG   Gemmatimonas phototrophica: GEMMAAP_19465Help
Entry
GEMMAAP_19465     CDS       T04580                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
gph  Gemmatimonas phototrophica
Pathway
gph00473  D-Alanine metabolism
gph00550  Peptidoglycan biosynthesis
gph01100  Metabolic pathways
gph01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gph00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    GEMMAAP_19465
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    GEMMAAP_19465
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    GEMMAAP_19465
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gph01011]
    GEMMAAP_19465
Enzymes [BR:gph01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     GEMMAAP_19465
Peptidoglycan biosynthesis and degradation proteins [BR:gph01011]
 Precursor biosynthesis
  Amino acid ligase
   GEMMAAP_19465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 GARS_A ATP-grasp_3 ATPgrasp_ST ATPgrasp_YheCD GSP_synth
Motif
Other DBs
NCBI-ProteinID: AMW06377
UniProt: A0A143BMT3
LinkDB All DBs
Position
complement(4644910..4645947)
Genome map
AA seq 345 aa AA seqDB search
MPTPLKITVLLGGVSAERDVSLSSGLRIAAALREKGHEVICLDPAEGVLTRETERGLLAT
GVGSAPPSLAALAGMAAQSLSPTLGTLPEVTEADCVFLALHGGQGEDGTVQALLDMVGVP
YTGSGHLASALAMDKHLSKVVLRAAGVATANWMMAPTDGSVLDPHEVGRHLDWPVVVKPS
KQGSTVGLSIVREPEALAAAVTEAFKYDDEVMVERFVPGQELTVGILGDQVLPTIEIVPM
KELYDYECKYTPGMAKEFVAELSDEVQSKLADQARKAFDALKLGGYARIDFRLDPQGQPW
CLEANTLPGMTPTSLIPQAAAAAGVLFPDLCERIVNLALAKQRDR
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgcccacccccctgaaaattacggtcctccttggcggcgtttccgccgaacgtgatgtc
tcgctgtcgagcgggctgcgcatagccgcggcgctccgcgagaaggggcatgaggtcatt
tgcctggaccccgcggagggggtgctgacgcgggagacggagcgggggttgctggcgacc
ggtgtggggagtgcgccaccgtcgctggccgccttggcggggatggcggcccaatcattg
tcgcccacgctggggacgctgccggaggtgaccgaggccgactgcgtgtttctggcgttg
cacggcggccagggggaagacggcaccgtgcaggcgctgctcgatatggtgggggtgccc
tatacggggagcggtcacctggcgagcgcgctggccatggacaagcacctgagcaaggtg
gtgttgcgggcggccggggtggcgacggccaactggatgatggccccgaccgacggctcg
gtgctcgacccccacgaggtggggcggcacctggattggccggtggtggtgaagccgtcc
aagcaggggagcacggtggggctcagcattgtccgggaaccggaggcgctggccgcggcg
gtgaccgaggcgttcaagtacgacgacgaagtgatggtggagcgcttcgtgccggggcag
gagctcacggtgggcattctgggcgatcaggtactgcccacgatcgagattgtgccgatg
aaggagctgtacgactacgagtgcaagtacacgccggggatggccaaggagttcgtggcc
gaactatcggatgaggtgcagtcgaagctggcggatcaggcccggaaggcgtttgacgcc
ctcaagctgggcggctacgcgcgcattgatttccggctggacccccaggggcagccgtgg
tgtctggaggccaacacgttgcccggtatgacacctaccagtctcatcccacaggcggcg
gccgccgctggtgtcttgtttcccgatctgtgtgagcgcatcgtcaatctggcgctcgcg
aagcagcgggatcggtag

DBGET integrated database retrieval system