KEGG   Geobacter pickeringii: GPICK_02375Help
Entry
GPICK_02375       CDS       T03568                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
gpi  Geobacter pickeringii
Pathway
gpi00473  D-Alanine metabolism
gpi00550  Peptidoglycan biosynthesis
gpi01100  Metabolic pathways
gpi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gpi00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    GPICK_02375
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    GPICK_02375
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    GPICK_02375
Enzymes [BR:gpi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     GPICK_02375
Peptidoglycan biosynthesis and degradation proteins [BR:gpi01011]
 Precursor biosynthesis
  Amino acid ligase
   GPICK_02375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp RimK ATP-grasp_3 GARS_A TTL
Motif
Other DBs
NCBI-ProteinID: AJE02376
UniProt: A0A0B5BE97
LinkDB All DBs
Position
519673..520614
Genome map
AA seq 313 aa AA seqDB search
MTRDELKTKKIGVLMGGLSAEREVSLASGAAVLQALRVRGYDAVAVDMDRDLPQVLAREG
IDVAFIALHGRYGEDGAVQGALELVGIPYTGSGVLASALAMNKIFAKQVFAASGLTVAPY
RVLRRGETPDVDSLGFSFPLVVKPSQEGSSVGVSIVRSAAALPAALEMAFRYDREILVEQ
FVKGREIQVGILDDRAMGAIEIVPKNEFYDYEAKYTDGMAEHICPPVLAPELYRKLLAEG
EKAHGALGCSGHSRVDFLVTEAGECFLLEVNTLPGMTSLSLLPEIAQKEAGIGFEELVER
ILGSASLKIAAGE
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgagacgaattgaaaaccaaaaaaataggcgtacttatgggggggctttccgcc
gagcgggaggtttcccttgccagtggcgccgcggtcctgcaggcgctccgggtgcgggga
tatgacgccgtcgccgtcgatatggaccgcgatctcccgcaggttctggctcgggagggg
atcgacgttgccttcatcgcgctccatggccgctacggcgaggacggtgcggtccagggt
gcactggagctcgtgggaattccgtacaccggctccggtgtgctcgccagcgcccttgcc
atgaacaagatctttgccaagcaggtctttgcggccagtggcctcaccgttgccccgtac
cgggtgctccgccggggagagacgccggatgtcgactccctcggattctcgtttccgctg
gtggtgaagccttcccaggaggggtcgtcggtgggggtgagcatcgtgcggtcggccgcg
gcccttcccgcggccctggagatggcgtttcggtacgaccgggagatcctcgtggagcag
ttcgtgaagggccgggagatccaggtggggatcctcgacgaccgcgccatgggggccatc
gagatcgtgccgaagaacgagttctacgattacgaggccaagtacaccgacggcatggcc
gagcatatctgtccgccggtccttgcacccgagctgtaccggaagctcctggccgagggg
gagaaggcccacggcgcccttggctgctccggccacagccgggtcgatttcctcgtgact
gaagccggagagtgtttcctcctggaggtcaataccctgccgggaatgacctccctgagt
ctgctgccggagatcgcccagaaagaggcgggaatcggcttcgaagaattggtggaacgg
attctcggctccgcctcgctgaagattgctgccggggagtag

DBGET integrated database retrieval system