KEGG   Geobacter pickeringii: GPICK_05315Help
Entry
GPICK_05315       CDS       T03568                                 

Definition
(GenBank) penicillin-binding protein
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
gpi  Geobacter pickeringii
Pathway
gpi00550  Peptidoglycan biosynthesis
gpi01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:gpi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    GPICK_05315
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    GPICK_05315
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gpi01011]
    GPICK_05315
Enzymes [BR:gpi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     GPICK_05315
Peptidoglycan biosynthesis and degradation proteins [BR:gpi01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   GPICK_05315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer NusA_N
Motif
Other DBs
NCBI-ProteinID: AJE02861
UniProt: A0A0B5BFN6
LinkDB All DBs
Position
1168200..1170119
Genome map
AA seq 639 aa AA seqDB search
MNGHRLIHESQGAKRHIAYLSIFAAALFFLLLTRLWYLQIVKSDELQSQSESNRLRLVPV
AASRGTIFDRNGGVLVTNRPSFSVAVIPQEVKDRDALLDRLSKYLDIDRSELLDKWEKGK
GRARYFPIVLASGITRDQLELLEENRLWLPGIEIEMKPVRQYESGTLAAHLLGYIGEVSE
EELKKDTTSGYNSGDYIGKSGIERSWETLLHGRDGGRQIEVDARGRVLRTISETAPVGGS
SLVLTIDTALQTAAEKGFGEQAGAAVAMDVNTGEILAFVSNPGFDPALFAGRMPPDKWKE
YLEDKRHPLENKALKGQYPPGSTFKIITALAGLEEGVVDDHTSSVCRGAYVLGNNTFRCW
EKRGHGTVNLKRALKESCDVYFYQLGEKLGIDRIAAYARKFALGAPLGIGLENEKAGLIP
DSAWKEKRFGKKWFQGDTLPAAIGQGYVLMTPVQLAAMIGAVANDGTVYRPHLVKRIIDQ
EGRILQEFKPEVVTRTGISPRSIRLVKEGLLAVVNEGGGTGGQARLYDVRVAGKTGTSQV
VKQRDKKGAIPYQYRDHALFVAFAPYDKPEIAVAVVVEHGEHGGSAAAPIAGNILRAYFE
GKKAASKPVKAGKAPASEEGDGAEQAGEEQTSPPASKEE
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgaatggtcatcgcctgattcacgaaagccagggggcgaagcggcatattgcctatctc
tccatcttcgcggcggcactctttttccttcttctgacccgcctgtggtatctgcagatc
gtcaaatccgacgagctccagagccagtccgaaagcaaccggctgcggctggttccggtg
gctgcgtcccgcgggacgattttcgaccgcaatgggggggtcctcgtgaccaaccggccg
tccttcagcgttgccgtcatcccccaggaggtcaaggaccgcgacgcccttctcgaccgt
ttgtcgaaatatctcgatattgaccgttccgaactcctcgacaagtgggaaaaggggaag
ggaagggcgcggtattttccgatcgtactggcatcgggcatcacccgcgaccaactggaa
ctgctggaggaaaaccgcctctggcttccgggcatcgagatcgagatgaagccggttcgt
cagtacgaaagcggcaccctcgcggcccatctcctcgggtacatcggggaggtttccgag
gaagagctgaagaaggataccaccagcggctacaattccggcgactatatcggcaagagc
ggcatcgagcggagttgggagacgctgctgcatggccgggacggggggcgccagatcgag
gtggatgcccgtggccgtgttctgaggaccatttctgagactgctcccgtggggggctcc
agcctcgtcctgaccatcgatacggcccttcagacggcggcggagaaggggttcggcgaa
caggccggcgccgccgtcgccatggatgtcaatactggcgagattctcgccttcgtgagc
aatcccggtttcgatccggcgctcttcgccggcaggatgccgccggacaagtggaaggag
tatctcgaggataaacgccatccgctggaaaacaaggctctcaaggggcagtaccctccc
ggttcgacattcaagatcatcactgcccttgccggcctggaggagggggtcgtcgacgat
catacctcatcggtctgcaggggggcctatgtcctcggcaataacacgtttcgctgctgg
gaaaagaggggccacgggaccgttaacctgaagcgggccttgaaggagtcgtgcgatgtc
tacttttaccagctcggtgaaaagctcggcatcgaccgtattgccgcttacgcccgcaag
tttgcccttggagcccccttggggatcggtcttgaaaacgaaaaggccggcctgattccg
gacagcgcctggaaggaaaagcgctttgggaaaaaatggttccagggcgacacgctgccg
gcggcgatcgggcaggggtacgtcctgatgacgccggttcagcttgcggccatgatcggt
gccgtggccaacgatggcaccgtctatcgcccccatctggtgaagcggatcattgatcag
gaggggagaattctccaggagttcaagccggaggtcgtgacccggacgggcatcagccca
cgcagtatccgtcttgtgaaagaggggctccttgccgtggtcaacgaagggggagggacc
ggcggccaggcccggctctatgatgtgcgggtggcgggaaagaccgggacttcgcaggtg
gtcaaacagcgggacaagaaaggggcgatcccctatcagtaccgcgaccacgccctgttc
gtcgcctttgccccctatgacaagccggaaatagccgtggcggtggtggtggagcacggc
gagcacgggggctctgccgccgcccccattgcgggaaatatcctgcgggcatactttgag
ggtaaaaaggccgcctcgaaaccggtcaaggcgggaaaggccccggcgtccgaggagggg
gacggggcggagcaggcgggtgaagagcagacgtctcccccggcgtcaaaggaagagtaa

DBGET integrated database retrieval system