KEGG   Geobacter pickeringii: GPICK_11495Help
Entry
GPICK_11495       CDS       T03568                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gpi  Geobacter pickeringii
Pathway
gpi00010  Glycolysis / Gluconeogenesis
gpi00020  Citrate cycle (TCA cycle)
gpi00620  Pyruvate metabolism
gpi01100  Metabolic pathways
gpi01110  Biosynthesis of secondary metabolites
gpi01120  Microbial metabolism in diverse environments
gpi01130  Biosynthesis of antibiotics
gpi01200  Carbon metabolism
Module
gpi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gpi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GPICK_11495
   00020 Citrate cycle (TCA cycle)
    GPICK_11495
   00620 Pyruvate metabolism
    GPICK_11495
Enzymes [BR:gpi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     GPICK_11495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: AJE03890
UniProt: A0A0B5BHE2
LinkDB All DBs
Position
complement(2551474..2552721)
Genome map
AA seq 415 aa AA seqDB search
MPTDITMPKLSDTMTEGRLVSWKKSVGEQIERGEIIAEVETDKATMELEAFASGVLAEQR
VKPGEMVAVGAVIGVIGGGGEAPPPAGEKPAPPPEGARQPPAEPPAPERAGEVPERVMEL
PGEEQPSPVSAGHSDDTKAAPAVRRLAREQGVDLARVAGSGPDGRILQEDLERYLAKRDE
EGTAGGAPAAAAGEGEPLTRMRGAIAKVTGEAWRTIPHFYETVEIDMKEAVEIVRELKGS
GHDATYNDLTIRAAAMALGSFPLMNASFAADRIVRHDAINIGFAVAMDDGLQVPVVKGCQ
GLSLAEIARQTVRLAERARSGAITQEEISGGTFSISNLGMFGIDEFAAVILPPQAAILAV
GAVAERPAVRDGHLVAAKTMRVTLSCDHRVVDGAYAARFLGELRRILENPVLMLV
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgccaaccgacataaccatgcccaaactctccgacaccatgaccgaggggcggctcgtc
tcctggaagaagagcgtcggcgagcagatcgagcggggggagatcattgccgaggtggag
accgacaaggcgaccatggagctggaggcgttcgcctcgggggtgctggccgagcagcgg
gtgaagccgggggagatggtggccgtcggcgcggtgatcggcgtcatcggcggggggggg
gaggctcctccccctgccggcgaaaagccggcgcctccccccgagggtgcccggcagccg
ccggcggaaccgccagcgccggaacgggcgggggaggtccccgagcgggtgatggaactc
cccggcgaggagcagccttccccggtctccgccggccactccgacgatacgaaggcggcg
ccggcggtgcgccgtctggcgcgggagcagggggtcgaccttgcccgggtggcaggcagc
ggccccgacggacggatcctccaggaagatctggagcggtatctggccaagcgggacgag
gaggggaccgccgggggcgccccggccgccgcggcaggggagggagagcccctcacgcgg
atgcgcggcgccatcgcgaaggtgacgggggaggcgtggcggacgatcccccacttctac
gagacggtggagatcgacatgaaggaggcggtggagatcgtccgggagctgaaggggagc
gggcacgacgccacctacaacgacctgacgatcagggcggcggccatggccctcggctcg
tttccgctgatgaatgcctccttcgccgccgaccggatcgtgcggcatgacgccattaac
atcggctttgccgtggcgatggacgacggcctccaggtgccggtggtgaaggggtgccag
gggctctccctggcggagattgcccggcagacggtgcgcctggcggaacgggcccgcagc
ggcgccatcacccaggaggagatctccggcggcaccttcagcatctccaacctggggatg
ttcgggatcgacgaattcgccgcggtgatcctccctccccaggcggcgatcctcgcggtg
ggagccgtggccgagcggccggcggtgcgcgacgggcacctcgtggcggcgaagaccatg
cgggtgaccctctcctgcgaccaccgggtggtggacggggcctacgccgcgcggtttctg
ggggagctgaggcggatactggaaaatccggtgctgatgctggtgtag

DBGET integrated database retrieval system