KEGG   Geobacter pickeringii: GPICK_14470Help
Entry
GPICK_14470       CDS       T03568                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
gpi  Geobacter pickeringii
Pathway
gpi00500  Starch and sucrose metabolism
gpi01100  Metabolic pathways
gpi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gpi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GPICK_14470
Enzymes [BR:gpi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     GPICK_14470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase
Motif
Other DBs
NCBI-ProteinID: AJE04398
UniProt: A0A0B5BCH7
LinkDB All DBs
Position
3179943..3182507
Genome map
AA seq 854 aa AA seqDB search
MDFVRSIHRFTVLPTLSGELAPLQKLAYNLWWTWEPEGVELFKRLDIDLWQQTRHNPVEM
LGILQQTTLEKLVADEGFMSQLQRVSEKFRDYMGARTWFDRSCNGGKSLIAAYFSMEFGL
HESLPTYSGGLGILAGDHLKSASDLGIPLVGIGLLYRQGYFRQYLNIEGWQQELYPENDF
YNLPLRLERDESGEPVAVVLDMAGRTVTAHIWSVQVGRVPLYLLDTNLEGNAPEDREITA
QLYGGDQEMRIRQEILLGVGGIRALHQLGITPNVCHMNEGHAAFLALERTRLLMEEHGLS
FAEAMEAVRAGNIFTTHTPVDAGIDHFPPDLLERYLGRLYRSLGISREEFLGLGRINPRN
LNETFCMAVLALKLANHANGVSQLHGEISRRMWKNLWPELPDEHIPITSVTNGVHTKTWL
SNEMAGLLTRYLGSRWREDSTDPVLWKRVANIPDSELWRTHERCRERLVLFARRRLKDHL
RQVGATAKEIAAAEEVLDPEALTIGFARRFATYKRGTLLFRDLARLERILGSSDRPVQII
FAGKAHPHDVEGKELIREIFQHSIGGRFRGKIVFIEDYDMAVARHLVQGVDVWLNTPRRP
LEASGTSGMKVAFNGGLNMSVLDGWWPEGYRGNNGWAIGNGEVYDDVDYQNEVESRAIYD
LLEKEIVPLFYDRGTDDIPRGWLSCIKASLQTLCPLFSTERMVQEYTQLCYLPAYGQWEK
LSGDRLALAVDLTRWKGEMHRGWSQVRVTRLDAGATAEVPLGAAIPVTAEVSLGDILPDQ
VTVDLYCGVLDSRGNIVGGELLPLSHGGAVSDGLHRFAGKIEPHFCGRHGFMVRVMPRHP
KIGPVYEQGLLAWG
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atggattttgtccgcagcatccaccggttcaccgtcctcccgaccctcagcggtgaactg
gcccccctgcagaagcttgcctacaacctctggtggacctgggagcccgaaggggtcgag
ctcttcaagcggctcgacatcgacctctggcagcagacccgccacaacccggtggagatg
ctcggcatcctccagcagacgacgctggagaagctggtggccgacgaggggttcatgtcg
cagctccagcgggtcagcgagaagttccgcgactacatgggggcccgcacctggttcgac
cgcagctgcaacggcgggaaaagcctcatcgccgcctacttctccatggagttcggtctc
cacgaatcgctccccacctactccggcgggctcggcatcctggcgggcgaccacctgaaa
tcggccagcgacctcggcatccccctggtggggatcgggctcctctaccgccagggatac
ttccgccagtacctcaacatcgaggggtggcagcaggagctctaccccgagaacgacttc
tacaacctgccgctgcgcctggaacgggacgagagcggcgagccggtggcggtggtgctc
gacatggcggggcggacggtgacggcccacatctggagcgtgcaggtggggcgggtcccc
ctctacctcctcgacacgaacctggaggggaatgccccggaggaccgggagatcacggcc
cagctctacggcggcgaccaggagatgcggatccgccaggagatcctcctcggcgtcggc
ggcatccgggccctgcaccagctcggcatcacccccaacgtctgccacatgaacgagggg
cacgcggcgttcctggccctggagcgaacccggctcctgatggaggagcacggcctgagc
ttcgcggaggcgatggaggcggtacgggccggcaacatcttcaccacccacaccccggtg
gacgccggcatcgaccacttcccccccgacctcctggagcggtacctagggcgcctctac
cgctccctcggcatctcccgcgaagagttcctggggctcggccggatcaatccccgcaac
ctcaacgagaccttctgcatggcggtcctcgccctgaagctcgccaaccatgccaacggc
gtcagccagctccacggcgagatctcgcggcggatgtggaagaacctctggcccgagctc
cccgacgagcatatccccatcacctccgtcaccaacggcgtccacaccaagacctggctc
tccaacgagatggcggggctcctcacccgctacctgggatcccgctggcgcgaggactcc
accgatccggtcctctggaagcgggtcgccaacatccccgactcggagctctggcggacc
cacgagcggtgccgcgaacggctcgtcctcttcgcccgccgccgtctgaaggaccacctc
cggcaggtgggggccaccgccaaggagatcgccgcggcggaggaggtcctggacccggag
gccctcaccatcggcttcgcgcgccgcttcgccacctacaagcgggggaccctcctcttc
cgcgatctggcgcggctcgaaaggatcctcggcagcagcgaccggccggtgcagatcatc
ttcgccggcaaggcccacccccacgacgtggaggggaaggagctgatccgcgagatcttc
cagcactccatcggcgggcgcttccgggggaagatcgtcttcatcgaggactacgacatg
gcggtggcgcgacacctggtgcagggggtggacgtctggctcaacaccccccgccgcccc
ctggaggcgagtggcaccagcggcatgaaggtcgccttcaacggggggctcaacatgagc
gtcctggacggctggtggcccgaggggtaccgggggaacaacggctgggccatcggcaac
ggcgaggtctacgacgacgtcgactaccagaacgaggtggagagccgcgccatttacgac
ctgctggagaaagagatcgtccccctcttttatgaccgggggaccgacgacatcccccgc
ggctggctctcctgcatcaaggcgagcctccagaccctctgccccctcttcagcaccgag
cggatggtgcaggagtacacccagctctgctaccttcccgcctacggccagtgggagaag
ctctccggcgaccggctcgccctcgccgtcgacctcacccggtggaagggggagatgcac
cggggatggagccaggtccgggtcacccgcctggatgcgggggccaccgccgaggttccc
ctcggagcggccatcccggtgacggcggaggtctccctcggcgacatcctccccgaccag
gtgacggtggatctctactgcggcgtcctcgactcccggggaaacatcgtcggcggcgaa
ctgctccccctctcccacggcggggccgtcagcgacgggctgcaccgcttcgccgggaag
atcgagccccatttctgcggcaggcacggcttcatggtgcgggtcatgccccggcacccg
aagatcggcccggtctacgagcaggggctcctcgcctgggggtga

DBGET integrated database retrieval system