KEGG   Geobacter pickeringii: GPICK_15145
Entry
GPICK_15145       CDS       T03568                                 

Definition
(GenBank) type VI secretion protein
  KO
K11895  type VI secretion system protein ImpH
Organism
gpi  Geobacter pickeringii
Brite
KEGG Orthology (KO) [BR:gpi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:gpi02044]
    GPICK_15145
Secretion system [BR:gpi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   GPICK_15145
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: AJE04517
UniProt: A0A0B5BDH0
LinkDB
Position
3333178..3334167
AA seq 329 aa
MAAPARTAPAPLETELLQRGHEFSFAQAMRLLRLLAPAPSAIRVRPELSLAFPAADVAQI
ERQDDGYRVTTRFLGLYGSASPLPTFYTEELIDEAREDSSASRDLLDILSQRLFELATAG
TAKYRLFFRTVEDESADDLERLFSLAGLGEAELRRSLPEPRRWLRYAGLLGHSPRSALGL
QTIIADVLAVPAEVFPCRLRRVAIPPDQRLAVGMTGSTLGTDTVVGGELEDRSGMFLLRL
GPLSREQFAAFLPGTPARRTLDLIVELYLDTPLAWDLELTLAPDEAPVASLGPLPGTRLG
WNGWLGRPAEGAQASVTFPHHPSQGVTHC
NT seq 990 nt   +upstreamnt  +downstreamnt
gtggccgccccggctcggacagcgcccgctcctctagagacggagctcctccagcggggg
cacgagttctccttcgcccaggcgatgcggctgctgcggctcctggctcccgccccctcc
gcgatccgggtccgcccggaactctccctcgcctttccggccgccgacgtggcacagatc
gagcgccaggacgacggctaccgcgtcacgacccggtttctcggcctctacggttcggct
tcccccctccccaccttctacacggaagagctcatcgacgaggcgcgggaggactcctcc
gccagccgcgacctcctcgacatcctgagccagcgcctcttcgaactcgccaccgccggc
acggccaagtaccggctcttcttccggacagtggaagatgaaagcgccgacgacctcgaa
cggctcttctccctggcgggtctcggcgaggcagaactgcggcgctccctccctgaaccc
cggcgctggctccgttacgcggggctcctggggcactctccccggtcggccctgggactg
caaacgatcatcgccgacgtccttgccgtcccggcggaggttttcccctgccggctaagg
cgggtcgcgatccccccggatcagcgcctcgccgtcgggatgaccggcagcaccctcggc
accgacacggtggtgggaggcgaactggaggaccggagcggcatgttcctcctccgcctc
ggccccctctcccgtgagcaattcgcggcctttctccccggcactccggcccgccggacc
ctcgacctcatcgtggagctctacctggacacccccctcgcctgggatctggagctgacg
ctggccccggacgaggcccccgtcgcctccctcggccccctgccggggacgcggctcggg
tggaacggctggctcggccggccggcggagggggcccaggccagcgtcacctttccccac
catccctcccaaggagtcacccattgctga

DBGET integrated database retrieval system