KEGG   Gordonia polyisoprenivorans: GPOL_c05470Help
Entry
GPOL_c05470       CDS       T01719                                 

Definition
(GenBank) putative fatty acid oxidation complex alpha-subunit
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
gpo00071  Fatty acid degradation
gpo00280  Valine, leucine and isoleucine degradation
gpo00281  Geraniol degradation
gpo00310  Lysine degradation
gpo00362  Benzoate degradation
gpo00380  Tryptophan metabolism
gpo00410  beta-Alanine metabolism
gpo00640  Propanoate metabolism
gpo00650  Butanoate metabolism
gpo00903  Limonene and pinene degradation
gpo00930  Caprolactam degradation
gpo01100  Metabolic pathways
gpo01110  Biosynthesis of secondary metabolites
gpo01120  Microbial metabolism in diverse environments
gpo01130  Biosynthesis of antibiotics
gpo01200  Carbon metabolism
gpo01212  Fatty acid metabolism
Module
gpo_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:gpo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    GPOL_c05470
   00650 Butanoate metabolism
    GPOL_c05470
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GPOL_c05470
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GPOL_c05470
   00310 Lysine degradation
    GPOL_c05470
   00380 Tryptophan metabolism
    GPOL_c05470
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GPOL_c05470
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    GPOL_c05470
   00281 Geraniol degradation
    GPOL_c05470
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GPOL_c05470
   00930 Caprolactam degradation
    GPOL_c05470
Enzymes [BR:gpo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     GPOL_c05470
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     GPOL_c05470
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     GPOL_c05470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 ECH_2 3HCDH UDPG_MGDP_dh_N F420_oxidored NAD_binding_2 NAD_binding_8 2-Hacid_dh_C NAD_Gly3P_dh_N DAO Shikimate_DH adh_short_C2
Motif
Other DBs
NCBI-ProteinID: AFA71616
UniProt: H6MV29
LinkDB All DBs
Position
643882..646041
Genome map
AA seq 719 aa AA seqDB search
MINWEKDADGVVILTMDDKSQGANTMNQTFMDSIAATVDRLEAEKDDITGVVITSAKKTF
FAGGDLKDMTAEQTQTKEEIATAITERTNGMKKVLRRLETLGKPVVAAINGAALGGGLEL
ALHTHHRIAADIKGVQIGLPEVTLGLLPGGGGVVRTVRLLGFQAALMNVLLQGPRFNAAK
AKETGLVDELVGSVEELVPAAKEWIKANPEAVQPWDVKGYKMPGGAVTNPSVAANLPAFP
AILRKQIKGANMPAPRAILAAAIEGAYVDVDTADIIETRYFVSLVTGQVAQNMIKAFFFD
LQHINNGGSRPEGYDKYTAKKVGVIGAGMMGAAIAYVSAKAGIEVVLKDIDIEAAKRGKG
YSEKLEEKALSRGKTTQEKSDALLARITPTVDAADFKGVDLVIEAAFESVEVKNKVFQEI
EDIVEPDAVLGSNTSTLPITILAQGVKRQEDFIGIHFFSPVDKMPLVEIIRGEKTSDAVL
AKVIDYTLQIRKTPIVVNDSRGFFTSRVIGTFINEAIAAVGEGVEPALVEHAGTQAGYPA
APLQLSDELNLILMQKIRKESQAAAEAEGKEFPQHGSFAVIDYLVEQGRPGKKEGAGFYE
YDENGKRVRLWPGLREKFNSGSSQQSLEDLKERMLFAEAVETARCIEEGVITSVPDANIG
SIFGIGFPAWTGGVVQYMNQYEGGLAGFVERSRELAKKYGAQFEPPASLVEKANKGEKY
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgatcaattgggagaaggatgccgacggcgtcgtcatcctgaccatggacgacaagagc
cagggcgccaacaccatgaaccagacgttcatggactcgattgccgccacggtcgatcgt
ctcgaggcggagaaggacgacatcaccggtgtcgtcatcacctcggcgaagaagaccttc
ttcgccggcggcgacctcaaggacatgaccgccgagcagacccagaccaaagaggagatc
gccaccgcgatcaccgagcgcaccaacggcatgaagaaggtgctgcgtcggctcgagacc
ctcggcaagccggtcgtcgccgccatcaacggtgccgcactcggtggcggcctcgagctc
gcgctgcacacccaccaccgcatcgccgcggacatcaagggtgtccagatcggtctgccc
gaggtcaccctcggcctgctgcccggtggcggtggcgtcgtgcgtaccgtgcgtctgctc
ggcttccaggccgcgctgatgaacgtgctcctgcagggcccgcggttcaacgccgccaag
gccaaggagaccggtctggtcgacgagctcgtcggctcggtcgaagaactcgtgccggcc
gccaaggaatggatcaaggccaaccccgaagcggtccagccgtgggatgtcaagggctac
aagatgcccggtggtgcggtcaccaatccgtcggtcgcggccaacctgcccgccttcccg
gcgatcctgcgcaagcagatcaagggcgccaacatgccggctccgcgcgccatcctggcc
gcggccatcgagggcgcctacgtcgacgtcgacaccgccgacatcatcgagacccgctac
ttcgtgtcgctggtgaccggtcaggtcgcgcagaacatgatcaaggcgttcttcttcgac
ctgcagcacatcaacaacggtggctcgcggccggaaggctatgacaagtacaccgccaag
aaggtcggcgtcatcggcgcgggcatgatgggtgcggcgatcgcctacgtctcggccaag
gccggcatcgaggtcgtcctcaaggacatcgacatcgaggccgccaagcggggcaagggc
tactcggagaagctcgaggagaaggcgctctcgcggggcaagaccacccaggagaagagt
gacgcgctgctcgcgcggatcacgccgaccgtcgacgccgccgatttcaagggtgtcgac
ctcgtcatcgaggccgccttcgagtcggtcgaggtgaagaacaaggtgttccaggagatc
gaggacatcgtcgagcccgacgccgtgctcggctcgaacacctcgacgctgccgatcacg
atcctcgcccagggcgtcaagcgccaggaggacttcatcggtatccacttcttctcgccg
gtcgacaagatgccgctggtggagatcatccgtggtgagaagacctcggatgcggtgctg
gccaaggtgatcgactacaccctgcagatccgcaagaccccgatcgtggtcaacgacagc
cgcgggttcttcaccagccgggtcatcggcaccttcatcaacgaggccatcgcggccgtc
ggcgaaggtgtggaaccggcactggtcgagcacgccggcacccaggccggatacccggcc
gcaccgctgcagctgtccgatgagctgaatctcatcctgatgcagaagatccgtaaggaa
tcccaggctgccgccgaggcggagggcaaggaattcccgcagcacggatcgttcgccgtc
atcgattacctcgtcgagcagggccgtcccggcaagaaggaaggcgccggcttctacgag
tacgacgagaacggcaagcgcgtgcggctgtggccgggtctgcgggagaagttcaactcc
ggaagcagccagcagtcgctcgaggacctcaaggagcgcatgctcttcgccgaggccgtc
gagaccgcgcgctgcatcgaggaaggtgtcatcacctcggtgcccgacgccaacatcggc
tcgatcttcggcatcggcttcccggcctggaccggcggtgtggtgcagtacatgaaccag
tacgaaggcggcctggccggcttcgtcgaacgctcgcgcgaactggccaagaagtacggc
gcgcagttcgagccgccggcctcgctggtggagaaggcgaacaagggcgagaagtactga

DBGET integrated database retrieval system