KEGG   Gordonia polyisoprenivorans: GPOL_c23170
Entry
GPOL_c23170       CDS       T01719                                 

Definition
(GenBank) putative aldolase
  KO
K18287  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase [EC:4.1.2.56]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
gpo00997  Biosynthesis of various secondary metabolites - part 3
gpo01100  Metabolic pathways
gpo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gpo00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    GPOL_c23170
Enzymes [BR:gpo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.56  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase
     GPOL_c23170
SSDB
Motif
Pfam: DeoC
Other DBs
NCBI-ProteinID: AFA73347
UniProt: H6N1M8
LinkDB
Position
complement(2618222..2619079)
AA seq 285 aa
MNTFPDGYRRPHPTGGKAIRLSRIADPVTMRSQIVPMDHSVTVGPLGPTHHTERMVRLLA
DSGCDAVVLHRGRAQQVSSTAFATMGLIVHLSASTSLGPDQDAKVLVGDVDAALRIGADA
VSVHVNVGSATETRQLQDFAAVSRECDALGVPLLAMMYARGPALPAKPAGTTLAHLAAIA
TDLGADMVKLDYAGSAEVMRAVVDSTPAPIYVAGGPGRTDDEAIEFGAEVLTSGVAGLSF
GRNIFDAADPFRVASSLADLVHRRAGTTAMARAGAPADVAALESA
NT seq 858 nt   +upstreamnt  +downstreamnt
atgaacacctttccggatggatatcgccgtccacatcccacgggcggcaaggctattcgg
ctctcccgcatcgccgatccggtgaccatgcgatcccagatcgtgccgatggaccattcg
gtcaccgtcggtccgctgggccccacgcaccacaccgaacgcatggtccggttgctggcc
gattccggctgtgatgccgtggtgctccaccgaggtcgcgcacagcaggtctcctcgacg
gcattcgccaccatggggttgatcgtgcacctgtcggcgagcacttccctcggtcccgac
caggacgcgaaggtactcgtcggggatgtcgacgccgccctgcggatcggcgcggatgcg
gtgagtgtgcacgtcaacgtcggctccgcgaccgagacacgacaactgcaggacttcgcc
gccgtctcccgggaatgcgacgcgctcggggtcccactactggccatgatgtacgcgcgc
ggtccggccctccccgccaagccggcgggaacgacgctggcccatctcgcggccatcgcc
accgatctcggtgccgacatggtcaaactcgactacgccggctccgcagaggtcatgcgg
gccgtcgtcgactccacccccgcaccgatctacgtcgccggcggcccgggtcgcaccgac
gacgaggccatcgaattcggcgccgaggtgctcaccagcggagtcgccgggttgagcttc
ggccgcaacatcttcgacgccgccgacccgttccgggtggccagcagcctggccgatctg
gtgcaccggcgcgcgggcaccaccgcgatggcccgcgccggagcgcccgccgacgtcgcc
gcgctcgaatcggcctga

DBGET integrated database retrieval system