KEGG   Gordonia polyisoprenivorans: GPOL_c34020Help
Entry
GPOL_c34020       CDS       T01719                                 

Gene name
gadB
Definition
(GenBank) glutamate decarboxylase GadB
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
gpo00250  Alanine, aspartate and glutamate metabolism
gpo00410  beta-Alanine metabolism
gpo00430  Taurine and hypotaurine metabolism
gpo00650  Butanoate metabolism
gpo01100  Metabolic pathways
gpo01110  Biosynthesis of secondary metabolites
gpo01120  Microbial metabolism in diverse environments
gpo02024  Quorum sensing
Module
gpo_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:gpo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    GPOL_c34020 (gadB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    GPOL_c34020 (gadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GPOL_c34020 (gadB)
   00430 Taurine and hypotaurine metabolism
    GPOL_c34020 (gadB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    GPOL_c34020 (gadB)
Enzymes [BR:gpo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     GPOL_c34020 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AFA74414
UniProt: H6MZ78
LinkDB All DBs
Position
complement(3823317..3824726)
Genome map
AA seq 469 aa AA seqDB search
MTKRKHTNARATTNLNDSLTVNPVFVRPGEATEYPKFAIPESMSLPETAYQIVHDEAMLD
GNARLNLATFVSTWMDDEARRLYAETYDKNMIDKDEYPQTAAIEDRCWKIIADLWHVPDV
DKSIGTSTIGSSEAAMLGGLALKRHWQARRKAEGKSIEKPNLVLSTAVQVCWEKFLNYFE
VEPRWVPVSQEHFVFDGHELETYVDENTIGVVAILGVTYNGLYEPVQQISAKLDEIEKNT
GLDVKIHVDGASGAMVAPFCQPDLEWDFRVSRVVSINTSGHKYGLVYPGLGWIVWRDSEA
LPESMVFHCSYLGGDMPTLALNFSRPGAQVLLQYYNFLRLGREGYRLIQQGSIDVATYLS
SAIAEMGPFELVSKGDTIPVFAWKLKDGYTDKWSLYDLSDRLRLKGWLVPAYPMADGLAD
WTLQRIVVRAGLSHDLATALLTDLESEVAFLDQLESPMPREGTGSHFHH
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagcgaaagcacaccaacgcccgcgccaccaccaatctcaacgattcgttgacg
gtgaacccggtgttcgtgcgccccggtgaggccaccgagtatccgaagttcgccatcccc
gagagcatgagtctgcccgagacggcctatcagatcgttcacgacgaggcgatgctcgac
gggaacgcgcggttgaatctggcgacgttcgtctcgacgtggatggatgacgaggcccgc
agactctatgcggaaacctacgacaagaacatgatcgacaaggacgagtacccgcagacc
gcggcgatcgaggatcggtgttggaagatcatcgccgatctctggcacgtgccggatgtc
gacaagtcgatcgggacctcgacaatcgggtcgtcggaggcggcgatgctcggcgggctc
gcgctcaagcgtcactggcaggcccggcgcaaggcggaggggaagtcgatcgagaagccg
aatctggtgttgtcgacggcggtgcaggtgtgctgggagaaattcctcaactatttcgag
gtcgaaccgcgctgggtgccggtgtcgcaggagcacttcgtcttcgacgggcacgagttg
gagacgtacgtcgacgagaacaccatcggggtcgtcgcgatcctgggcgtgacctacaac
ggcttgtacgaaccggtacaacagatctcggcgaagctcgacgagatcgagaagaacacc
gggctcgacgtcaagatccacgtcgacggtgcgtcgggtgcgatggtggcgccgttctgt
cagccggacctggaatgggatttccgtgtctcgcgggtggtgtcgatcaacacctcggga
cacaagtacgggctggtgtatccgggtctgggatggatcgtgtggcgcgacagcgaggcc
ttgccggagagcatggtgttccactgcagctacctcggtggcgacatgccgacgctggca
ctgaacttctcgcgtccgggcgcgcaggtgttgttgcagtactacaacttcctgcggttg
ggacgcgaaggatatcggttgatccagcagggatcgatcgacgtggccacgtatttgtcg
tcggcgatcgccgagatgggaccgtttgagttggtcagcaagggtgacacgattccggtg
ttcgcgtggaagctgaaggacggttacaccgacaagtggtcgctgtacgacctgtcggat
cggttgcggctcaagggatggttggtgcccgcctacccgatggccgacgggttggccgac
tggaccctgcagcggatcgtggtgcgtgcggggttgagtcacgatctggcgacggcgctg
ctgaccgatctggagagtgaggtcgcgttcctggatcagctggagtcgccgatgccacgc
gagggaaccggctcccacttccatcactga

DBGET integrated database retrieval system