KEGG   Gordonia polyisoprenivorans: GPOL_c47210Help
Entry
GPOL_c47210       CDS       T01719                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
gpo  Gordonia polyisoprenivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AFA75720
UniProt: H6N063
LinkDB All DBs
Position
complement(5335474..5336544)
Genome map
AA seq 356 aa AA seqDB search
MGDDGEVDLPVTPPVAPMLAKAASMVPAQPADNPEWSYEPKWDGFRALIFRDGDEVVIGS
RGGKDLARYFPEIVAAAREELPLKVVLDGEIGVPSLIGDTHRLDWDSLAQRIHPAASRVA
MLAETTPAIFIGFDALALGNVGVIDESFVTRREALVEAIGPGGRDRRFHVSRVTADPAVA
EDWFSAFEGAGLDGVVAKPLAGHYVENKREMIKVKHKRTADCVVIGYRVHKSGTGLGSML
LGLFYDGELRMVGGAGAFTDAKRAELQQMFEPMRLDPDKPSAGEPTRWRSEKSGEWIPIR
PELVAEVAYDQMENGRFRHTVKFLRWRPDREPDSCGYEQLDVPLTYDLHDVLEGLD
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
gtgggtgacgatggtgaggtggatctccccgtcactcctccggtcgcgccgatgctcgcc
aaagcggcgagcatggttccggcccaacccgccgacaatccggaatggtcctacgagccg
aaatgggacggattccgcgcgttgatctttcgcgacggcgacgaggtcgtcatcggctct
cgcggtggcaaggacctcgcacgctactttcccgagatcgttgccgctgcccgcgaggag
ttgcccctgaaagtggtgctcgacggggagatcggtgtgccctcgctcatcggcgacacc
catcgactcgattgggactcgctggcccagcgcatccatccggcggcttcgcgggtcgcg
atgctcgccgagaccacaccggcgatcttcatcggcttcgacgccctggcgctcgggaac
gtcggtgtgatcgacgagtctttcgtcaccaggcgcgaggcgctcgtggaggccatagga
ccgggcgggcgcgatcgccgattccatgtcagccgggtgaccgccgatccggccgtcgcc
gaggactggttctcggcgttcgagggcgccggactcgacggcgtcgtcgccaaacccctt
gccggccactacgtggagaacaagcgcgagatgatcaaggtcaagcacaagcgaaccgcc
gactgcgtggtgatcggctaccgcgtgcacaagagcggtaccggtctggggtcgatgctg
ctcgggctgttctacgacggcgagctgcgaatggtcggcggcgcaggagctttcaccgat
gccaaacgcgccgagctgcagcagatgttcgagccgatgcgtctcgacccggacaaaccc
tccgccggggaaccgacgcggtggcgttcggagaagtcgggggagtggattccgatccgg
cccgaactcgtcgccgaggttgcctatgaccagatggagaacggccgcttccggcacacc
gtcaagttcctgcggtggcgtcccgaccgcgagcccgacagctgtggatacgagcagctc
gacgtgccgctgacctacgacctgcacgatgtgctggaagggctggactga

DBGET integrated database retrieval system