KEGG   Paraglaciecola psychrophila: C427_0738
Entry
C427_0738         CDS       T02535                                 

Definition
(GenBank) YjgP/YjgQ family permease
  KO
K07091  lipopolysaccharide export system permease protein
Organism
gps  Paraglaciecola psychrophila
Pathway
gps02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:gps00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    C427_0738
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gps02000]
    C427_0738
Transporters [BR:gps02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Lipopolysaccharide transporter
    C427_0738
SSDB
Motif
Pfam: LptF_LptG
Other DBs
NCBI-ProteinID: AGH42848
UniProt: K7A2X3
LinkDB
Position
689738..690847
AA seq 369 aa
MLIFRYLMKETLKSQLAIFMLLMAIFITQKFVKVLADASEGEIPAGLVLGFLALHTPVLA
SLVLPLSLFLGIMLAHGRLYVDSEMSVMRACGISEWYITRVMLILALFMSLLTAGLTMWL
TPLAIESTYQLEEKVGAQSGLSSLIPGRFQQTANQQAVIFVHDIDNGQNPLRKVFLAQRD
TDSDTENVRIVYANRGGIEEQANGAQKLILNQGKQYEGEMGRQDYRVVEFEEYQIQIAEQ
QPERKRRKLSAYPTADLLVDPSVDALAELHWRIAIPLSLPFLVLIAVPLSAADPRQGRFG
KMFPALMLYLGYFMLLMAGRKALEDGNIPQQLGLWWVHGVLLSIGIALLLKGRPFGVKLR
ARLRGDTSV
NT seq 1110 nt   +upstreamnt  +downstreamnt
gtgctgattttccgctatttaatgaaagaaacgttgaagtctcaactggcaatttttatg
ctgttgatggctatttttattactcaaaaatttgttaaagtattggctgatgcatcagaa
ggagaaattcctgctggcttagtactaggctttttggctttacacacgccggtcttagcg
tcactagtgcttcccttgagtctttttttggggatcatgttggctcatggccgattgtac
gtcgacagtgagatgagtgtgatgcgagcatgtggtatcagtgagtggtatatcacccgt
gtcatgctgattttggccttatttatgtctttattaaccgctggcttaactatgtggtta
acgcccttagctattgaaagcacctatcaactagaagaaaaagtcggtgctcaaagtggc
ttatcaagcctgatccctggtcgtttccaacaaactgccaatcagcaagccgtgatattt
gttcatgacatcgataatggccaaaatcccttaagaaaggtttttctggcacaaagagat
actgactccgataccgaaaatgtaagaattgtgtatgcaaacagggggggcatcgaagaa
caagccaatggcgcacaaaaactgatactcaatcaaggtaaacaatacgagggtgaaatg
ggcaggcaagattatcgcgttgttgaatttgaagagtatcaaattcaaattgcagagcaa
cagcctgaaagaaaacgcagaaaactaagcgcatatccgactgccgacttattagttgat
ccttcagttgatgcgctagcagagcttcactggcgaatagctattcctctatcgttaccg
tttttagtattgattgcggtgcccctcagtgccgctgatcctagacaaggtcgctttgga
aaaatgtttcctgcgttgatgttatatctgggctactttatgctgctcatggcgggccga
aaagcgttggaagatgggaacataccccagcaactagggttatggtgggtgcacggtgta
ttgttatcgatcggtattgcattattactaaaaggtaggccttttggcgtcaagctgcgc
gctcgattaagaggtgataccagtgtttaa

DBGET integrated database retrieval system