KEGG   Paraglaciecola psychrophila: C427_2225Help
Entry
C427_2225         CDS       T02535                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase catalytic subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
gps  Paraglaciecola psychrophila
Pathway
gps00020  Citrate cycle (TCA cycle)
gps00190  Oxidative phosphorylation
gps00650  Butanoate metabolism
gps01100  Metabolic pathways
gps01110  Biosynthesis of secondary metabolites
gps01120  Microbial metabolism in diverse environments
gps01130  Biosynthesis of antibiotics
gps01200  Carbon metabolism
Module
gps_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gps_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
gps_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:gps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C427_2225 (sdhA)
   00650 Butanoate metabolism
    C427_2225 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    C427_2225 (sdhA)
Enzymes [BR:gps01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     C427_2225 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     C427_2225 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like DAO FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AGH44334
UniProt: K7A6E1
LinkDB All DBs
Position
2096916..2098685
Genome map
AA seq 589 aa AA seqDB search
MSLPVHEFDAVVIGAGGAGMRAALQITESGKSCALLSKVFPTRSHTVSAQGGITVALGNA
HEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAIIEMENMGLPFSRFENGKIYQRPFG
GQSQNFGGEQGARTAAAADRTGHALLHLLYQQNVKNKTKIFSEWYALDLVKNQDGDVVGC
TAIDIESGEVVYFKSKAVVLATGGAGRIYASTTNAHINTGDGLGMALRAGVPMQDMEMWQ
FHPTGIAGAGTLVTEGCRGEGGYLLNKNGERFMERYAPNAKDLAGRDVVARSMMTEIREG
RGFDGPQGPHCKLKLDHLGKDVLESRLPGILELSRTFAHVDPIKEPIPVIPTCHYMMGGI
PTNVDGQALTMDVNGKTSPIKGLFACGEIACVSVHGANRLGGNSLLDLVVFGRATGLHLG
KAIDGIDAREASEDDVDQAMVRFNRWENSPVGKGEDPVQIKKDLQQCMQLNFSVFREGES
MATGLKELNDIRERLDNASLNDKSNDFNTMRIECLELDNLMETAYTTAVASNFRTESRGA
HSRFDFPDRDDKDWLCHSVYLPDSKSMIKREVNMSPKLREAFPPKARTY
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgagtcttcctgtacatgaatttgatgcagtcgtaattggtgctggcggcgcaggtatg
cgcgcggcgttacagattacagaatcgggtaaatcgtgtgccctattatctaaagttttc
cctacacgttctcatacagtatcggcacagggtggtattactgttgctcttggtaatgct
catgaagataactgggaatggcacatgtacgatacggtcaaaggttccgattatattggt
gatcaagacgcaatcgaatatatgtgtaaaacaggtcctgaagccattattgaaatggaa
aatatggggttgcctttttctcgcttcgaaaatggaaaaatttatcaacgtccgttcggc
ggccaatctcaaaactttggtggagagcaaggcgcacgtactgcagcagcagctgataga
acgggtcacgcattattacatttgctttatcaacaaaatgttaaaaataaaactaaaata
ttcagtgagtggtatgcactcgatttggtaaaaaatcaagacggtgatgtagtgggttgt
actgccattgatatcgagtctggtgaagttgtatatttcaaatctaaagcagtagtatta
gcaaccggtggggctgggcgtatttacgcttcaactactaatgctcatattaatactggc
gacggcttaggtatggcactacgtgctggtgttcccatgcaagatatggaaatgtggcag
ttccacccaacagggattgcaggtgctggtaccctagtaaccgaaggttgtcgtggtgaa
ggcggttaccttctaaataaaaacggcgaacgttttatggaacgatatgcgcctaatgcc
aaagatttagccggacgagacgttgttgctcgttcgatgatgacagaaattcgtgaaggt
cgtggcttcgacggtccacaaggtccacattgtaagctgaagcttgatcacttaggtaaa
gatgttcttgaatctcgtctgccaggtatcttagaattatctcgtacattcgctcacgtc
gaccccattaaagagccaattcctgtcattccaacttgtcattatatgatgggcggtata
ccgaccaatgttgacggacaagcgcttaccatggacgtaaatggaaaaacttcacctatt
aaagggttgtttgcttgtggtgaaattgcatgtgtatcagtacatggtgccaacagacta
ggtggtaattcattattagacttagtcgtttttggccgtgctacaggattacatcttggt
aaagcgattgatggtatcgatgctcgtgaagcgtcagaagatgatgttgatcaagcgatg
gtgcgctttaatcgctgggaaaattcaccagtgggtaaaggcgaagatcctgttcaaatt
aagaaagacttgcagcaatgtatgcaattaaacttctcggtatttcgtgaaggtgagtca
atggctacaggtttgaaagagttaaatgatatccgagaaagattagataacgctagcctt
aatgataagagtaatgactttaatactatgcgtatcgaatgtcttgaactcgataattta
atggaaactgcctacaccacagctgtagcgtctaatttcagaacagagagtcgcggtgct
cacagtcgttttgattttcctgatagagatgataaggattggttatgccattctgtttat
ttaccggattcaaaatcaatgataaaacgtgaagtgaatatgtcacccaagttgcgtgaa
gcctttccacctaaagcaagaacatactag

DBGET integrated database retrieval system