KEGG   Paraglaciecola psychrophila: C427_2226Help
Entry
C427_2226         CDS       T02535                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
gps  Paraglaciecola psychrophila
Pathway
gps00020  Citrate cycle (TCA cycle)
gps00190  Oxidative phosphorylation
gps00650  Butanoate metabolism
gps01100  Metabolic pathways
gps01110  Biosynthesis of secondary metabolites
gps01120  Microbial metabolism in diverse environments
gps01130  Biosynthesis of antibiotics
gps01200  Carbon metabolism
Module
gps_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gps_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
gps_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:gps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C427_2226
   00650 Butanoate metabolism
    C427_2226
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    C427_2226
Enzymes [BR:gps01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     C427_2226
    1.3.5.4  fumarate reductase (quinol)
     C427_2226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_18 Fer4_9 Fer4 Fer4_6
Motif
Other DBs
NCBI-ProteinID: AGH44335
UniProt: K7AB38
LinkDB All DBs
Position
2098697..2099407
Genome map
AA seq 236 aa AA seqDB search
MQLNLSVYRYNPDIDNAPRMQDYQLEVAEGQDMMVLDALIALKEKDPTLSFRRSCREGVC
GSDGVNMNGKNGLACITPISALKGSKIVVRPLPGLPVVRDLVTDMTQFYTQYEKIKPYLI
NDDKQPPAREFLQSPEEREKLDGLYECILCACCSSSCPSFWWNPDKFIGPAGLLHAYRFL
ADSRDTATDERLNGLDDAFSVFRCHGIMNCVSVCPKGLNPTKAIGHIKSMLLKRAV
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgcaattaaatctttcagtctaccgttacaatcctgatattgataacgctcctcgtatg
caagattatcagttggaggtcgcagaaggccaagacatgatggtattggatgcattgata
gcattaaaagaaaaggatcctactctgtcatttcgtcgttcatgccgtgaaggtgtatgt
ggctctgatggcgtaaacatgaatggtaaaaatggcttagcgtgcatcacaccaatatca
gcacttaaaggttctaagatagtggttcgtccattacctggattacctgtggtgcgtgat
ttggtaactgatatgacgcaattttatactcagtatgaaaaaataaagccgtaccttatt
aacgacgataagcaaccgccagcccgtgagtttttgcagtcccctgaagaaagagaaaag
ctagatggtttgtacgagtgcatattgtgtgcatgttgttcaagctcttgcccatctttc
tggtggaacccagataagtttattggccctgccggtttgttacatgcctatcgcttccta
gctgatagcagagatacagcaactgatgaacgtttaaatggcttagatgatgcatttagt
gtatttagatgccatggcatcatgaactgcgtcagtgtttgtccaaagggattaaaccca
acaaaagcgattggtcatatcaaatctatgctgctcaaacgagcagtgtag

DBGET integrated database retrieval system