KEGG   Paraglaciecola psychrophila: C427_3429Help
Entry
C427_3429         CDS       T02535                                 

Definition
(GenBank) hypothetical protein
  KO
K12472  epidermal growth factor receptor substrate 15
Organism
gps  Paraglaciecola psychrophila
Brite
KEGG Orthology (KO) [BR:gps00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gps04131]
    C427_3429
Membrane trafficking [BR:gps04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    C427_3429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAS_4 PAS_8 PAS PAS_9
Motif
Other DBs
NCBI-ProteinID: AGH45538
UniProt: M4RSB1
LinkDB All DBs
Position
complement(3287235..3291173)
Genome map
AA seq 1312 aa AA seqDB search
MLDEQGKFTDCNSAFESMFKQRLSKILHKSLQEIDILPAEINRLHTQNSANFSSVNAGHD
KEFELQLADEVVHTLKLKLKFFSDNNKKRAGVVGVIQDVTELKETKNQLEQERKHFITIL
DLAPLAVATIDAEDRIVRANIAMTDRLGLSERELKKDTIYQLFNDSSNAGKAAKQIHQTG
RLRGFVAHLKGKNDELHPSELHVDCLNKEKQEYLCWITDRTKEQFHQDKFDGLLQHSSMP
MAIFGEQGFSKLNPAACSFFNVQDEHELFGSSPFAAELNLDQQASEELERHLTKVKLDGQ
AKSLQWEHKVGQVSLPCQATYVPMYKGQDFDSILCIWTDFRDLQLADEARIEALNLHQAA
EKEVAEKQQLLQSSRDQLATKVKNLADTETRLQAAQDDLSEKQSEFSDLQQAHQSVTDNL
QELQQDYNQSRSQLSEAQNVNSELSIQLEESTTKVTGLQAQRNQISDALQHSEKKYKTAQ
QELIESERNAENLKQEQYSQQANMDDFVSEIDGFKQSIEQKDLQINEVGGQINSLQSELT
SSGNTSEKLRQLLVNQRKASEQAEEQRRNLEQTYKIAESELSNKVRHVEHLQNEMQKFEE
MSNQQKGDMQQQQSQLVQELESKQQQLQETQQALDETKQAAEQDKVAKEQQQNQLEILQQ
ELSEMESHSQQQQQKMAETEHEWQAQQQQIQQELAAKQQQLQDTERTLQQAKEQSETEKA
DKEQQLALFENLQSELAEVELRNKQQQQQIALRDGEYQQQQANMQQELKDKQQQLQDTEQ
NLSQAKEQTEAEKKQQQALFETLQHELSEMESRNVQQQQQMAKSDKEWQLQQQKVQQELI
DKQQQLQQSEQLLSQTKQQTEAEKAAERAEKEQQQALFEKLQNELAEMEQQSTQQQQKIA
QSDQDWQNQQQALQDEVEAKRQQLQNTQGNLDDIKRQADAEKIARLEQQQKLEQLTVELT
DVESRAVKQKEMIEGSDEQWRKHHAEIEQQKLQLQQALIEAEQQNIQMQQKLEGNLEQLQ
QAESQVSETQSGEQKLQHELNQARDQAEQLQQRIQQQEEHERKLQEQLEQQQQSLQGSEQ
SIHSLEEKQALLTEQLQAVQQEYSNSKESLSDRHIDHTELAEQLQKLEQDLHYSQSQLSD
KESALQEAKQELESNQAKLVEQESALLSAHKEELQQAIEQQPLQENKAPSDIAKIVMPGN
PAIWFDLLPYLQNQNVTKPLPVVLNELMDELENGIKETDIAVDEDDVACILRGARKLVIV
ANKVNSEALTDVVTRLEADCRQGLVDNISISWPTVQRSLNNTLRVIYSHLNN
NT seq 3939 nt NT seq  +upstreamnt  +downstreamnt
ttgcttgatgaacaaggtaaattcactgattgcaattcagcctttgagtcgatgtttaaa
caaagattgtcaaaaattctgcataaaagcttacaagaaattgacatactgcctgctgag
attaatcgtctgcatacccagaacagtgcaaattttagttcagtcaatgcagggcacgat
aaagagttcgaattgcagcttgctgatgaagtggtccacacacttaaattaaagttaaag
tttttttcagataataataaaaaacgcgccggtgtggtgggagtcattcaagatgtgacc
gaacttaaagaaaccaaaaatcagcttgaacaagaacgaaaacattttattactattttg
gacttagcacctctagctgtagccactattgatgccgaagaccgcattgttagagctaat
attgctatgacggatagattaggtttaagtgaaagagagctgaaaaaagataccatttat
cagctgtttaacgactcgagtaatgcaggtaaggccgctaaacaaattcatcagactgga
agattacgtggttttgtcgcgcacttaaaaggtaaaaatgatgaattacatcccagtgag
ttacacgtcgattgtctaaataaagaaaaacaagagtacttgtgctggattacagaccgc
actaaagaacagttccatcaagataagtttgatgggttattgcaacacagcagtatgcca
atggctatttttggtgagcaaggctttagtaaattgaatcctgcagcttgctcatttttt
aatgtacaagatgaacatgagttatttggcagcagcccttttgcagcagagttaaatcta
gatcaacaagcatctgaagagctagaaaggcatttaaccaaagttaaactagatgggcag
gccaaatcattacaatgggagcataaagtgggccaggtctctttaccttgccaagcaacc
tatgtgcctatgtataaaggtcaagacttcgattcaattctatgtatttggaccgacttt
agggatttacagttagcggatgaagcacgtattgaggcgctgaatttacatcaagctgcc
gagaaagaagtcgcagagaaacaacaacttttacaaagcagccgtgatcagttggcgaca
aaggtcaaaaatttagcagatacagaaacaaggctacaagctgctcaagatgacttatct
gaaaaacaaagtgaattcagcgatttacaacaggctcaccaaagtgtcaccgataatctt
caagagttgcaacaggattataatcagagtcgttctcagctaagcgaggcgcaaaatgtt
aacagtgaattaagtattcaattagaagagtccacgactaaagtgacggggttacaggcc
cagcgcaatcaaatttcagacgctttacaacacagcgagaaaaaatataaaactgctcaa
caagagctgattgaaagcgaacgtaatgctgagaacttgaaacaggaacagtatagccaa
caagcaaatatggatgattttgtgtcagaaattgatgggtttaaacagtccattgagcaa
aaagatctacagattaatgaagtcggtggtcaaatcaattcattgcagtctgagttgacg
agctcaggcaataccagtgaaaaactgcgtcagttattggttaatcagcgcaaggccagt
gaacaagcagaggagcaacgccgaaaccttgaacagacttataaaatagctgagtcagag
ttatctaacaaagtgcgtcatgttgagcatttgcaaaacgagatgcaaaaatttgaagaa
atgtcgaatcaacaaaaaggcgacatgcagcaacagcaaagccagttggtgcaagagtta
gagtcaaaacagcaacaattacaagaaacccaacaagctctagatgaaaccaaacaagca
gccgaacaagataaggtggctaaagaacaacaacaaaatcaattagaaatattgcaacaa
gaactgtctgagatggaaagtcatagccagcaacaacagcagaaaatggcagaaactgaa
catgagtggcaggcacaacagcaacaaattcaacaagaattagctgctaagcagcagcaa
ttgcaagacaccgaacgcaccttacagcaagctaaagaacaaagtgaaacagaaaaagca
gataaagagcaacaacttgctctgttcgaaaatttacaatcagaacttgcagaagtggag
ctgcgcaataaacagcagcaacaacaaatagccctaagagacggtgaataccagcaacaa
caagcaaacatgcagcaagagcttaaagataagcagcagcagctccaggacactgagcaa
aacttgagtcaagccaaagagcaaactgaagcagagaaaaaacaacaacaagccttattc
gagacattacaacatgagctaagtgaaatggagtcacgcaacgttcagcagcagcagcaa
atggcaaaaagtgataaagaatggcagttgcaacagcaaaaagtacaacaagagttaatt
gataaacaacaacaattgcaacaatcagagcaattgttgtcacaaactaaacagcaaact
gaagcagaaaaagcagcagaaagagccgagaaagaacaacaacaagcactgtttgagaaa
ctccagaatgagctggcagaaatggagcagcaaagtactcagcagcaacagaaaatagcc
cagagcgaccaagattggcaaaatcaacaacaagcgttgcaagatgaggtcgaggctaaa
cgtcaacagttgcaaaatactcagggtaatttggatgatattaaacgccaagcagatgct
gaaaaaattgctcgtttagaacaacaacagaaactagagcaattgacggttgaactcacc
gatgtagaaagccgtgcggtcaaacaaaaagaaatgattgaaggcagtgatgaacaatgg
cgtaagcatcatgcagaaattgagcaacaaaaattacaattacaacaggctttgattgaa
gctgaacagcaaaatattcaaatgcaacagaagctcgaaggtaacttagaacaactgcaa
caagcagagtcacaagtatcagaaactcaatcgggcgaacaaaagctgcaacatgaactc
aatcaagctcgtgaccaagcagagcagttgcaacaacgtatacaacaacaagaagagcat
gaacgtaaactacaagagcagctcgaacagcaacagcaaagtttacagggcagtgaacag
agtattcattctttagaggaaaaacaggctctgttaactgagcaattacaagctgtgcaa
caggaatactcaaacagtaaagagagtttaagcgaccgacacattgatcacactgagtta
gcagagcagttacaaaaactggaacaggatttacactacagtcaatctcagttaagtgat
aaagaatcggctctgcaggaagcaaaacaagagttagagtcgaatcaggcaaaactagtg
gaacaagagagcgcattgttatctgcacataaggaagagctgcagcaagccatagagcag
caaccgctgcaagaaaacaaagcaccatctgacattgccaaaattgtgatgcccggtaac
cctgctatttggtttgatttattgccatacttacaaaatcagaatgtgactaagcctttg
ccagttgtcttaaatgagctgatggatgagttagaaaacggtatcaaagaaactgatatt
gccgtagatgaagatgacgtggcttgtattttacgcggtgcccgaaagctggtgattgtg
gcaaataaagtcaattccgaagcattaaccgacgtggtaacaaggttagaagctgactgt
cgtcaaggccttgtggataatatatctatctcttggcctacagtgcaacgttcattaaac
aataccttacgcgtcatttattcgcatttgaataattga

DBGET integrated database retrieval system