KEGG   Paraglaciecola psychrophila: C427_3484Help
Entry
C427_3484         CDS       T02535                                 

Definition
(GenBank) serine-type D-Ala-D-Ala carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
gps  Paraglaciecola psychrophila
Pathway
gps00550  Peptidoglycan biosynthesis
gps01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gps00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C427_3484
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gps01002]
    C427_3484
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gps01011]
    C427_3484
Enzymes [BR:gps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     C427_3484
Peptidases and inhibitors [BR:gps01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   C427_3484
Peptidoglycan biosynthesis and degradation proteins [BR:gps01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   C427_3484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 CytoC_RC
Motif
Other DBs
NCBI-ProteinID: AGH45593
UniProt: K6ZJC8
LinkDB All DBs
Position
3342572..3343615
Genome map
AA seq 347 aa AA seqDB search
MDFQTGNVIAEQNADIQIPPASLTKMMTSYVIGIELLNGNIKDSDLVTISENAWAKNFPD
SSKMFIEVGKKISVADLNRGIIVQSGNDACVAMAEHIAGSEGAFASMMNMHAEKLGMTST
YFVNSHGLHDAQHFTTPRDMAILSAALIRDVPEEYAIYAEKEFTFNDIKQYNRNGLLWDK
SLNVDGIKTGHTSDAGYSLITSAYQGDMRLISVVMGTDSERARKVENKKLLKYGFRFFET
ITPYKAGDSFVSHRIFMGDKETVDLGILQDTPINIPRGQSKNLKANFKLDKDLQAPIAKG
EVVGKLYLQIEGEDIAEYPLVALQEVKEGGFIDRMVDFVKLRLGFDS
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggatttccaaacgggtaatgttatcgcagagcaaaatgctgatattcagatccctccc
gctagcttaactaaaatgatgacaagctatgtgattggcatagagcttctaaatggcaat
atcaaagactccgatttggtgactatttctgaaaacgcctgggctaaaaactttccagac
tcctcaaagatgtttatcgaagtaggtaaaaaaatatctgtagcagatctaaatcgcggt
attattgtgcagtcaggtaatgatgcctgtgtcgccatggcagaacatattgctggtagt
gaaggtgcctttgccagcatgatgaatatgcatgcagaaaagctaggtatgacatcaact
tattttgtgaacagtcatggtttacatgatgcccagcatttcaccacacccagagatatg
gcaatcttatcagcagcattgatacgtgacgttccagaagaatatgctatctatgctgaa
aaagaatttactttcaacgatattaaacaatacaaccgtaatggcctattatgggataaa
agcctaaatgttgacggtataaaaaccggccacacatcagatgcaggttacagcttgatt
acatctgcgtaccaaggcgacatgcgtttaatctcagtggttatgggcacagacagtgaa
cgggctcgtaaggttgaaaacaaaaaattactcaagtatgggtttcgtttctttgaaact
attaccccttataaagccggtgacagctttgtttcacaccgtatttttatgggtgacaaa
gaaacggtagaccttggtatattacaagatacccccatcaatatacctcgaggtcaaagc
aaaaatttaaaagctaactttaagttagacaaagacttgcaggcacctattgctaaaggt
gaagtagtaggcaaactctatctgcaaattgagggcgaagatattgctgaatacccatta
gtggctctacaagaagtcaaagaaggtggatttattgaccgtatggttgattttgttaaa
ttacgacttggctttgatagttaa

DBGET integrated database retrieval system