KEGG   Paraglaciecola psychrophila: C427_3755Help
Entry
C427_3755         CDS       T02535                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
gps  Paraglaciecola psychrophila
Pathway
gps00071  Fatty acid degradation
gps00280  Valine, leucine and isoleucine degradation
gps00281  Geraniol degradation
gps00310  Lysine degradation
gps00360  Phenylalanine metabolism
gps00362  Benzoate degradation
gps00380  Tryptophan metabolism
gps00410  beta-Alanine metabolism
gps00627  Aminobenzoate degradation
gps00640  Propanoate metabolism
gps00650  Butanoate metabolism
gps00903  Limonene and pinene degradation
gps00930  Caprolactam degradation
gps01100  Metabolic pathways
gps01110  Biosynthesis of secondary metabolites
gps01120  Microbial metabolism in diverse environments
gps01130  Biosynthesis of antibiotics
gps01212  Fatty acid metabolism
Module
gps_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:gps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C427_3755
   00650 Butanoate metabolism
    C427_3755
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C427_3755
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C427_3755
   00310 Lysine degradation
    C427_3755
   00360 Phenylalanine metabolism
    C427_3755
   00380 Tryptophan metabolism
    C427_3755
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C427_3755
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C427_3755
   00281 Geraniol degradation
    C427_3755
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C427_3755
   00627 Aminobenzoate degradation
    C427_3755
   00930 Caprolactam degradation
    C427_3755
Enzymes [BR:gps01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     C427_3755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AGH45863
UniProt: M4RT79
LinkDB All DBs
Position
complement(3612588..3613475)
Genome map
AA seq 295 aa AA seqDB search
MTDIDLAALETLSVNIENHIAHIQLCRPEALNSMVPAFWRELPAVVRQIDEGSQARVIVI
SSQGKHFSAGMDLSVFTNMAKDFQGEPARRAERTRRLVLELQDSFNALEEVRMPVLVAVQ
GGVIGGAVDMICAADSRYCTEDAYFTIKETELGMTADVGTLQRLPHLMPQGLIRELAYTG
RNMPSCEAKECGFVNQVFADQDAMLAGVMNIAAKIAMHSPMAVAGCKEMINYTRDHSVTD
SLTYMATWQSGMFQMPDVQEAMTAAQQKRLPVYAELYKKIVWHVSQGYKKTDSNQ
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
gtgactgatatcgatttagctgcgctagaaacgttgtctgtgaatatcgaaaaccacatt
gctcatatccaattgtgccgtccagaggcgctcaatagtatggtgccagcattctggcgt
gaactacctgctgttgtaagacaaattgatgagggatcgcaagcacgggtgattgtgatt
tcttcacagggtaaacattttagtgcgggcatggatttgtctgtcttcactaatatggca
aaagactttcagggtgaaccagcgagaagagcagaacgaactcgtcgactggtacttgaa
ctacaagatagttttaatgctcttgaagaagtacgtatgccagtattagtggcagtgcag
ggcggtgtgatcggtggtgcggtagacatgatttgtgctgccgatagtcgatattgtact
gaagatgcttatttcactatcaaggaaaccgagttgggcatgaccgcggatgtaggcacg
ttacaacgattaccgcatcttatgccacagggtttgatccgcgagttggcctacaccggt
cgcaatatgccaagttgcgaagctaaagaatgtggttttgttaatcaagtgtttgcagac
caagatgcgatgcttgcaggcgtcatgaatatcgcagctaagattgccatgcattcccct
atggcagtggcgggttgtaaagaaatgatcaactatacgcgtgatcacagtgttaccgac
agcttaacctacatggccacatggcaaagcggcatgttccaaatgcccgatgttcaagaa
gccatgactgcagcgcaacaaaagcgtttaccggtgtatgcagaattatataaaaaaatc
gtctggcatgtaagtcagggttataaaaaaactgattcgaaccaatag

DBGET integrated database retrieval system