KEGG   Paraglaciecola psychrophila: C427_4843Help
Entry
C427_4843         CDS       T02535                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
gps  Paraglaciecola psychrophila
Pathway
gps00620  Pyruvate metabolism
gps00680  Methane metabolism
gps01100  Metabolic pathways
gps01120  Microbial metabolism in diverse environments
gps01200  Carbon metabolism
Module
gps_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:gps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    C427_4843
  09102 Energy metabolism
   00680 Methane metabolism
    C427_4843
Enzymes [BR:gps01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     C427_4843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 RdDM_RDM1
Motif
Other DBs
NCBI-ProteinID: AGH46942
UniProt: K6Z4H3
LinkDB All DBs
Position
4675639..4678260
Genome map
AA seq 873 aa AA seqDB search
MTQALDSQLVGTVRNLGAVLGDTIRDQLGEQWLERIEAVRKDGRKAHQGDEESAKRVKQL
FTELKNDELLTVGRAFSQFLNLANIAEQEFNSNNDQVDPMDTLFSHLDQADIKADTFEKA
LQHLNIELVLTAHPTEVTRRTLIHKHSELAKCLSKVHVSDINEVERDKIETRIAELISQA
WHTEEIRTIRPTPVDEARWGFSVIENSLWEAVPDFIRELDKRFVDKFGLSIPLDVSPVKF
GSWMGGDRDGNPFVTSKVTEQVLLLARKRAAKLFAKDIDILQTELSMSDCDDDLRAKVGD
ELEPYRAILRPLLEKLVKTQTGIVEKLKGIPVDMTDWVDNKEQLLVPLMTCYHSLQACGM
SVIAQGHLQNTIRRIHCFGVHLLKLDVRQDSERHADVFSELTRYLGLGDYGQWSEDDKQA
FLLKELGSKRPLFPPAWQPSEDVQEVLDTCKVIAQNGKDGFGIYIISMASLPSDVLSVNL
LLKELGVTWPMPVAPLFETLDDLNAAASVTKKLFSIDWYRGYIQAHQYVMIGYSDSAKDA
GAMAAGWAQYESQEALVALAEENDIELTLFHGRGGTIGRGGLPAHAAILSQPPGSLTGGF
RVTEQGETIRYKFGMPILAQRSLALYASAILEALILPPPAPKQAWREAMIKMAADGRDNY
RQIVRHDENFVPYFRVATPEQELGKLPLGSRPAKRKPTGGIESLRAIPWIFAWAQTRMVL
PSWLGVMKSVQSSLDAGKEDTIQDMLANWPFFYSRLSMLDMVFAKADPKISQEYDKSLVP
KELRHFGDALRTELQQSIDLLLKLLDQKTVMESDPKGSVSMNIRASYLQPLHYLQIELLK
RIRQLDDKEHDATLERAMMVTIAGIAVGMRNTG
NT seq 2622 nt NT seq  +upstreamnt  +downstreamnt
atgacacaggctttagattcccagttagtaggaacagtgcgtaatttaggcgctgtatta
ggcgacaccatacgtgatcagttgggcgagcaatggttagagagaattgaagcggtcaga
aaagatgggcgcaaggcccatcaaggtgatgaagaaagcgctaaacgtgttaagcaattg
tttactgaattaaaaaatgatgaattactcacggtaggtcgcgctttctctcaattttta
aacttagcgaacattgcagaacaagaatttaacagcaataacgaccaagttgatcctatg
gacactttatttagtcatttggatcaagccgatataaaggccgacacgttcgaaaaagcg
ctacagcatttaaatattgaactggtattaacagcgcacccgacagaagtgactcgccgg
actttgatccataagcacagcgagcttgcgaaatgcttaagtaaagtacatgtctctgac
atcaatgaagtagagcgagacaaaattgaaactcgtattgctgaacttatcagtcaggct
tggcataccgaagaaattcgcactatccgccctaccccagtagacgaagcgcgttggggg
ttttcggtcattgaaaactcactgtgggaagcggtacccgattttattcgtgaattggat
aagcgttttgtcgacaaatttggcttgtcgatcccgttagatgtatcacctgtgaaattt
ggttcgtggatgggcggcgatagagatggcaaccccttcgtcacctcgaaggtaacagag
caagtcttgcttttagcccgtaaacgcgctgctaaattgtttgcaaaagacattgatatc
ttacaaaccgaactatctatgagcgattgtgacgatgatctaagggctaaagtaggcgat
gaactagaaccttatcgtgccattctaaggccccttttagaaaaattagtcaaaacacaa
acaggcatagttgagaagctcaaaggtattcctgtcgatatgaccgattgggtagataac
aaagaacagttgcttgttcctttgatgacttgttaccactcattacaggcctgtggcatg
tctgttatcgcccaagggcacctacaaaacactatacgtcggatccactgttttggtgtg
catctacttaagttggacgtacgtcaagattcagaaagacatgcagatgtattttctgaa
ctgacccgttacttaggtttaggtgattacggccagtggagtgaagacgacaaacaagca
tttttacttaaagaactgggttcaaaacgcccattgtttccgccagcatggcaacccagt
gaagatgttcaagaagtattagacacctgtaaagtgattgcacaaaacggcaaagacggc
tttggtatttatatcatttctatggctagcttgccctcagacgtactaagtgtgaactta
ttgcttaaagaacttggtgtgacttggccaatgccagtggcacctctgtttgaaacatta
gacgacctaaatgcagctgcaagtgttaccaaaaaactgttttctattgattggtatcgc
ggttatatccaagctcatcaatatgtgatgattgggtattcagactcggctaaagatgct
ggtgcgatggcagctggttgggcgcagtatgaatctcaagaagccttggttgcactcgcc
gaagaaaatgacattgaattaaccttgttccatgggcgaggcggcaccattggtcgtggc
ggtttaccagctcacgcagcgatactgtcacagcctccaggttcgttaactggcgggttc
agagtcaccgaacaaggcgaaaccattagatataaatttgggatgcctatcctagcgcag
cgcagtttggcactttatgctagcgcaatattagaagcgctgattttaccgccaccggca
cctaaacaagcatggcgcgaagccatgataaaaatggcagcagacgggcgcgacaactat
cgccaaattgtcagacatgacgaaaattttgtaccttactttcgtgtggccacaccagaa
caagaactaggaaaattaccactaggcagccgccctgccaaacgcaaacctacaggaggc
attgaaagtctccgtgctatcccgtggatatttgcatgggctcaaacccgtatggtatta
ccttcttggttaggggtaatgaaatcagtgcaaagttctttagatgctggcaaagaagac
accattcaagatatgttagctaactggccgtttttctattctcgtctttcgatgttagat
atggttttcgctaaagccgacccaaaaatcagccaagaatacgataagagtttagtgcct
aaagaactcagacatttcggtgatgcattgcgcaccgagctgcaacaaagcatagactta
ttacttaaattgcttgatcaaaaaacggtaatggaaagcgatccaaaaggttcggtttca
atgaatatccgagccagttatttacaaccattgcactacttacagatcgaactccttaag
agaataaggcaactagatgataaagagcatgatgctactttagagcgcgctatgatggtt
acaatagcaggtatcgccgtggggatgagaaacaccggttaa

DBGET integrated database retrieval system