KEGG   Gibbsiella quercinecans: AWC35_01310Help
Entry
AWC35_01310       CDS       T05060                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
gqu  Gibbsiella quercinecans
Pathway
gqu00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:gqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AWC35_01310
Enzymes [BR:gqu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     AWC35_01310
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     AWC35_01310
    1.1.1.-  
     AWC35_01310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N ADH_zinc_N_2 Methyltransf_24 F420_oxidored 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ATA18097
UniProt: A0A250AVY1
LinkDB All DBs
Position
complement(271648..272703)
Genome map
AA seq 351 aa AA seqDB search
MKAARWYKARDIRVEDIAEPTASAGQVKIKVAWTGICGSDLHEYIAGPIFIPVNAPHPLS
HDRAPIVLGHEFSGEVVAVGSGVTHCQPGDRVVVEPILACGHCAACKQDKYNLCSQLGFH
GLSGGGGGFASYTVVQAQRVHKMPDALSFEQGALVEPAAVALHAVRMSRLKAGDKAAVFG
AGPIGLLIIEALRAAGASEIYAVELSPQRAAKATELGARAVIDPGKEDAVARLQALSDGG
VDVAFEVTGVPAVLAQCINSTHYEGETVVVSIWEKEASFQPNTLVLHERSVKGIIAYRHI
FPAVMELMTRGYFQADKLVSKKILLDDIVEQGFETLVREKQQVKILVQPPV
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcagcgcgttggtacaaggcccgcgatatccgggttgaggacattgcagaacct
accgcctctgccgggcaggtgaagatcaaagtagcgtggacgggcatttgcggtagcgat
ctgcacgaatacatcgccgggccgatttttattccggttaatgcgccacacccgcttagc
cacgatcgcgcgccgattgtgcttggccatgagttttccggtgaggtggtggccgtgggc
agcggcgtgacgcattgccaaccgggcgatcgggtggtggtggagccgattctggcctgc
ggccactgcgccgcctgcaagcaagataagtacaatctgtgcagccagcttggtttccac
ggcctgtcgggcggcggcggcgggtttgccagctataccgtggtgcaggcgcagcgggtg
cacaagatgccggatgcgctgtcctttgaacagggggcgttggtggagccggcggcggtg
gcgctgcatgcggtgcgcatgagccggttgaaggccggcgacaaggcggcggtgtttggt
gccgggccaatcggcctgctgattattgaggcgctgcgtgcggcgggcgccagtgagatc
tatgccgtcgagctttctccgcagcgggcggccaaggcgacggaattgggcgccagggca
gtgatcgatcccggcaaagaagatgcggttgcccgcttacaggcgctgagcgacggcggg
gtggatgtggcgtttgaagtcaccggcgtgccggcggtgctggcgcagtgcattaacagc
acccattacgaaggggaaaccgttgtggtttccatctgggaaaaagaagcctcgtttcag
cccaatacgctggtgctgcatgagcgctcggtgaaaggcatcatcgcctatcggcatata
ttcccagcggtaatggaactgatgacccgcggctattttcaggccgataagctggtgagc
aagaagatcctgttagacgacattgtcgagcaggggtttgaaaccctagtgcgcgaaaag
caacaggttaaaattctggtgcagccgccggtatag

DBGET integrated database retrieval system