KEGG   Gibbsiella quercinecans: AWC35_02910Help
Entry
AWC35_02910       CDS       T05060                                 

Definition
(GenBank) hypothetical protein
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
gqu  Gibbsiella quercinecans
Pathway
gqu00040  Pentose and glucuronate interconversions
gqu00051  Fructose and mannose metabolism
gqu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AWC35_02910
   00051 Fructose and mannose metabolism
    AWC35_02910
Enzymes [BR:gqu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     AWC35_02910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ATA18382
UniProt: A0A250AXF0
LinkDB All DBs
Position
complement(649623..650603)
Genome map
AA seq 326 aa AA seqDB search
MSEIKFATRLNSFASGAFRYWPGLKGKPSVLQMIERAGTVKGLTHLDLNYPQHITDDLKT
LRQKIEDVGLAVNGMQMRWDAPEFKIGAFTNPDATIRRQAIELTKRGIDAGREFGAGLMT
LWMGQDGFDYCFQADYKKIWEDAVSAVREVAEYAPDIDISIEYKPNEPRAFSIFPNATTC
LLAVEEAGCRNLGITLDFAHVLFANEVPAFAAAMVARRSRLLGLDLNDGWGKRDDGLMVA
SVNPRATLEFLWQMKRDGYQGAYYFDTFPDASGLDPVREAETNIATVTRLLALCEKLEGN
AELLAAIGRQDAVASQQIVNDLMLAR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaaattaaatttgccacacgtctgaactcctttgcgtcaggggcctttcgctac
tggccgggattgaagggcaagccgtcggtattgcaaatgattgaacgtgccggaacggtg
aaaggcttaacccacctggatctgaactatccccagcacatcaccgacgatctgaagacc
ttgcgtcagaagattgaagacgtggggctggcggtcaacggtatgcaaatgcgctgggac
gcgccggagtttaaaatcggcgcgtttaccaacccggatgcaacaatccgccgtcaggcg
atcgaactgaccaaacgcggcattgacgccggccgtgaattcggcgcgggtttaatgacg
ctgtggatggggcaggacggctttgattactgcttccaggccgattacaaaaaaatctgg
gaagatgccgtcagcgcagtgcgcgaagtggcggagtatgcgccggatatcgacatcagc
atcgaatataagcccaacgaaccccgcgccttcagcattttccccaacgcgaccacctgc
ctgctggcggtggaagaagccggctgccgtaacctgggcatcacccttgattttgcccat
gtgctgtttgccaatgaagtcccggcctttgccgccgccatggtggcgcgccgctcacgc
ctgctcggcctggatctgaacgacggttggggcaagcgcgatgatggcctgatggtcgct
tccgtcaacccgcgcgccacgctggaattcctctggcagatgaagcgcgacggttatcag
ggcgcttactacttcgataccttcccggatgccagcggccttgatccggtgcgtgaagca
gaaaccaatatcgccacggtgacccgcctgttagcgctgtgcgaaaaactggaaggcaac
gccgaactgttggcggccattggccggcaggatgcggtggcttcacagcagatcgtcaac
gacctgatgctggccagataa

DBGET integrated database retrieval system