KEGG   Gibbsiella quercinecans: AWC35_03030Help
Entry
AWC35_03030       CDS       T05060                                 

Definition
(GenBank) 3-oxoacyl-ACP synthase
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
gqu  Gibbsiella quercinecans
Pathway
gqu00061  Fatty acid biosynthesis
gqu00780  Biotin metabolism
gqu01100  Metabolic pathways
gqu01212  Fatty acid metabolism
Module
gqu_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:gqu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AWC35_03030
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AWC35_03030
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:gqu01004]
    AWC35_03030
Enzymes [BR:gqu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     AWC35_03030
Lipid biosynthesis proteins [BR:gqu01004]
 Fatty acid synthase
  Component type
   AWC35_03030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N
Motif
Other DBs
NCBI-ProteinID: ATA22306
UniProt: A0A250B8A1
LinkDB All DBs
Position
complement(678346..679575)
Genome map
AA seq 409 aa AA seqDB search
MRRVVITGMGGVTAFGNDWGSVSAGLLAGRNAVRNMPEWQVYDGLHTLLGAPIDHFSLPE
HYTRKRIRSMGRVSLLATRACELALEQAGLLGHPVLTNGETGIAYGSSTGSTGPVSEFAT
MLTEKHTNNITGTTYVQMMPHTTAVNAGLFFGLRGRVIPTSSACTSGSQAIGYAWEAIRH
GYQTIMVAGGAEELCPSEAAVFDTLFATSQRNDAPHTTPSPFDAKRDGLVIGEGAGTLIL
EELEHAQARGATIYAELVGFHTNCDAAHITQPQRETMQLCIEGALRCAGLQPADIGYISA
HGTATDRGDVAESQATAAVYGAATPISSLKSYFGHTLGACGALEAWMSIEMMRAGWFAPT
INLSQPAQDCGELDYIMHEPRRVETDFIQSNNFAFGGINTSLIFRRWAA
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgtgtagtgatcaccgggatggggggcgtgaccgcgttcggcaatgattggggc
agcgtatccgccgggctgctggccgggcgcaatgccgtgcgcaacatgccggagtggcag
gtgtatgacgggctgcatacgctgcttggcgcgccgattgatcatttcagcctgccggaa
cactatacccggaaacgtattcgctcaatggggcgcgtatcgctgctggccacccgggcc
tgtgagttggcactggagcaggcaggtttgctcggccatccggtgttgaccaacggtgaa
accggcatcgcctatggctcgtctaccggcagcaccggcccggtaagcgagttcgccacc
atgttgacggaaaagcataccaacaacattaccggtacgacctatgtgcaaatgatgccg
cacacgacggcggtcaatgccgggctgttttttggcctgcgtgggcgagtgatccccact
tccagcgcctgtacttctggcagccaggcgataggctacgcctgggaagcgattcgccac
ggttatcagaccattatggtcgccggcggagcggaagagctctgtccttctgaggcggcg
gtttttgacaccttgttcgccaccagccagcgtaacgatgcgccgcataccacgccgtcg
ccttttgatgcgaaacgtgatgggttggtgatcggcgagggggcgggaacgttgatcctt
gaagagcttgagcacgcacaggcgcgcggtgcgacgatctacgctgaactggttggcttc
catactaattgcgatgccgcccacattacgcaaccgcaacgcgagaccatgcaactctgt
attgaaggtgcgctgcgttgtgcgggcctgcaaccggccgatatcggctatatcagtgcg
catggcacggccaccgaccgtggcgatgttgccgagagccaggcgaccgccgcggtgtat
ggcgcagcgacgccgatttcgtcgttgaaaagctattttggccatacgctcggcgcctgt
ggcgcgctggaggcctggatgagcatagagatgatgcgtgctggctggtttgccccaacg
attaatctgtcgcagccggcgcaggattgcggtgagctggactacatcatgcatgagccg
cgccgcgttgagacggattttatccagtcgaataactttgcttttggcggcatcaatact
tcgctgatattccgccgctgggcggcataa

DBGET integrated database retrieval system