KEGG   Gibbsiella quercinecans: AWC35_05430Help
Entry
AWC35_05430       CDS       T05060                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
gqu  Gibbsiella quercinecans
Pathway
gqu00020  Citrate cycle (TCA cycle)
gqu00190  Oxidative phosphorylation
gqu00650  Butanoate metabolism
gqu01100  Metabolic pathways
gqu01110  Biosynthesis of secondary metabolites
gqu01120  Microbial metabolism in diverse environments
gqu01130  Biosynthesis of antibiotics
gqu01200  Carbon metabolism
Module
gqu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gqu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
gqu_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:gqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AWC35_05430 (sdhB)
   00650 Butanoate metabolism
    AWC35_05430 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AWC35_05430 (sdhB)
Enzymes [BR:gqu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AWC35_05430 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     AWC35_05430 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_18 Fer4_9 Fer4
Motif
Other DBs
NCBI-ProteinID: ATA18828
UniProt: A0A250AXW7
LinkDB All DBs
Position
complement(1207883..1208599)
Genome map
AA seq 238 aa AA seqDB search
MKLEFSIYRYNPDVDDAPHMQDYTLEAEDGRDMMLLDALIQLKEKDPTLAFRRSCREGVC
GSDGLNMNGKNGLACITPVSALRKGNNKIVIRPLPGLPVIRDLVVDMGQFYTQYEKIKPY
LLNDGKNPPAREHLQSPEQRAKLDGLYECILCACCSTSCPSFWWNPDKFVGPAGLLAAYR
FLIDSRDTETAERLDDLNDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRSA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgaattttcaatctatcgctataacccggatgttgatgatgcgccgcacatg
caggattacacgctggaagcggaagacggccgggatatgatgttgttggacgcgctgatc
caactgaaagaaaaggatccgaccttggcgtttcgccgttcctgccgtgaaggggtctgc
ggctccgacgggctgaatatgaacggtaaaaacggcctggcctgtatcaccccggtatct
gcgctgcgcaaaggcaataacaagatcgtgatccggccgctgccgggattgccggtgatc
cgcgatctggtggtggacatggggcagttctatacccagtatgaaaagattaagccttac
ttattgaatgacggtaaaaatccaccggcgcgcgaacacctgcaatcgccggagcagcgc
gctaaactggatggtttgtatgagtgcattctgtgtgcctgctgttcaacctcgtgcccg
tcattctggtggaaccctgataagttcgttgggccggctgggctgctggcggcataccgc
ttcctgatcgacagccgcgataccgaaacggcagaacgtttggatgatctgaacgatgct
tttagtgttttccgctgccatagcattatgaattgtgtcagtgtatgtcccaaaggcctt
aatccaacgcgtgcaattggccatattaagtcaatgttgctgcagcgtagcgcttaa

DBGET integrated database retrieval system