KEGG   Gibbsiella quercinecans: AWC35_09045Help
Entry
AWC35_09045       CDS       T05060                                 

Definition
(GenBank) beta-lactam-binding protein
  KO
K18988  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase [EC:3.4.16.4 3.4.21.-]
Organism
gqu  Gibbsiella quercinecans
Brite
KEGG Orthology (KO) [BR:gqu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gqu01002]
    AWC35_09045
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gqu01011]
    AWC35_09045
Enzymes [BR:gqu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AWC35_09045
   3.4.21  Serine endopeptidases
    3.4.21.-  
     AWC35_09045
Peptidases and inhibitors [BR:gqu01002]
 Serine peptidases
  Family S12: D-Ala-D-Ala carboxypeptidase B family
   AWC35_09045
Peptidoglycan biosynthesis and degradation proteins [BR:gqu01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   AWC35_09045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: ATA19476
UniProt: A0A250B082
LinkDB All DBs
Position
1988421..1989563
Genome map
AA seq 380 aa AA seqDB search
MKNRFSASLLALGLCAMPLASQAATPQLASQIVDQYAEHIFYNSGAVGMALVVIDGNQIV
NRSFGDTRPGNNLRPRPDSLIRIASITKLMTSEVMVKMAAEGQVKLTDPLSKYAPRGTRV
PGYNNRQPITLLNLATHTSGLPREQPGQKPPKTPVFTWPTKAQRWQWLAQAAITVPPGVR
AAYSNLAYDLLADALSRAAAKPYNALLREKVTAPLGMVDTTFSPSAEQCSRLMVPAAGPS
ACRDTTAAAGSGGIYSTPRDMQRWMQQFLASNNSGPRKTTAASEQTMYFQRNDLVSLKGM
DVPGQADALGLGWVYMAPKDGLPGIIQKTGGGGGFITYMAMVPQQNIGVFVVVTRSELSK
FTNMSDPVNRLVGDLLANRG
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaaccgattctccgcatctttgctggcgctgggcctttgcgccatgccgctggcc
agccaggccgctactccccagttggcttcacagatcgtcgatcagtatgccgagcatatt
ttctataatagcggcgctgtcggtatggcgctggtggtgatcgacggtaaccagatcgtc
aaccgcagctttggcgacaccaggccggggaataacctgcgcccgcggccagattcgtta
atccgtatcgcatcaatcaccaagctgatgaccagtgaggtgatggtaaaaatggcggcg
gaaggccaggtcaaactgaccgatccattgagcaaatacgcgccgcgcggcacgcgcgtg
ccgggctataacaacaggcagccgatcaccctgctcaacctggcgacccacaccagcggg
ctgccgcgggaacagccgggccagaagccgccgaaaacgccggtattcacctggccaacc
aaagcccaacgttggcagtggctggcgcaggccgctattactgtcccaccgggcgtacgg
gccgcctattccaacctggcgtatgatttactggccgatgcgctgtcgcgcgccgcggca
aaaccctataacgccctgctgcgggaaaaagtcaccgcgccgctgggcatggtggacacc
acgttcagccccagcgccgagcagtgttcgcgcctgatggtgccggcggctggcccgagc
gcctgccgcgatacgaccgctgcggccggtagcggcggcatttactcaacgccgcgcgat
atgcagcgttggatgcagcaatttttggcgtccaacaacagtgggccacgcaaaaccacc
gccgccagtgagcaaaccatgtatttccagcgcaacgatctggtttcgctgaaaggcatg
gatgtgccgggccaggccgatgccctggggctgggttgggtttacatggcgccaaaggat
ggcctgccgggcatcatccagaaaaccggcggcgggggcggcttcattacctatatggcg
atggttcctcagcaaaacatcggcgtgtttgtcgtcgtcacgcgctctgaactaagcaaa
ttcaccaacatgagcgatccggtcaaccggctggtcggtgatctgctggcgaatcgcggg
taa

DBGET integrated database retrieval system