KEGG   Gibbsiella quercinecans: AWC35_13805Help
Entry
AWC35_13805       CDS       T05060                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
gqu  Gibbsiella quercinecans
Pathway
gqu00480  Glutathione metabolism
gqu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gqu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AWC35_13805
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gqu02000]
    AWC35_13805
Enzymes [BR:gqu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AWC35_13805
Transporters [BR:gqu02000]
 Other Transporters
  Pores ion channels [TC:1]
   AWC35_13805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 GST_N_4
Motif
Other DBs
NCBI-ProteinID: ATA20326
UniProt: A0A250B2N0
LinkDB All DBs
Position
3029736..3030404
Genome map
AA seq 222 aa AA seqDB search
MIIVHHLNNSRSQRILWFLEELNVPYQVQRYQRDSVTMLAPPALKKVHPLGKSPVIEDGD
LVLAESGAIIEYLQEAYDAQGLFMPTDFHARQQHRYWLHYAEGSLMPLLVMKLVFGRLDH
PPMPWLMRPLAGAIGKGVQREYLDKQIAGHRAYLEQHLAKSAWFVGNDFSAADIQMSFPI
EAMAARGGLNGCPQLSDFLQRIHARPAYQRALQQGGPFELPR
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgattattgtccaccacctgaacaactcgcgttcgcagcgtattctgtggttcctggaa
gaattgaacgtgccgtaccaggtgcagcgctatcagcgcgatagcgtgaccatgctggcg
ccgccggcgctgaaaaaggtgcacccgctgggcaagtcgcccgtgattgaggatggcgat
ttggtgctggcggaatcgggcgccatcattgaatacctgcaagaggcctatgatgcgcag
ggcctgtttatgcccaccgactttcacgcgcgccagcagcaccgctactggctgcattat
gctgaagggtcgttaatgccgctgctggtgatgaaactggtgttcggccgtttggatcac
ccgccgatgccttggctgatgcgcccgctggcgggcgctatcggcaaaggggttcagcgt
gaatacctggataaacagattgccggccaccgcgcttatcttgaacagcacctggccaaa
agcgcctggtttgtcggcaatgacttcagcgccgccgacatccagatgagctttcctatc
gaagcgatggcggcgcgcggcggcctgaacggttgcccgcagttgagcgatttcttgcaa
cgcatccatgcccgccccgcttatcaacgcgccctgcaacagggcggcccgtttgaattg
ccgcgttaa

DBGET integrated database retrieval system