KEGG   Gibbsiella quercinecans: AWC35_13895Help
Entry
AWC35_13895       CDS       T05060                                 

Definition
(GenBank) acetyl-CoA carboxylase biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
gqu  Gibbsiella quercinecans
Pathway
gqu00061  Fatty acid biosynthesis
gqu00620  Pyruvate metabolism
gqu00640  Propanoate metabolism
gqu01100  Metabolic pathways
gqu01110  Biosynthesis of secondary metabolites
gqu01120  Microbial metabolism in diverse environments
gqu01130  Biosynthesis of antibiotics
gqu01200  Carbon metabolism
gqu01212  Fatty acid metabolism
Module
gqu_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:gqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AWC35_13895
   00640 Propanoate metabolism
    AWC35_13895
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AWC35_13895
Enzymes [BR:gqu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     AWC35_13895
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     AWC35_13895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C ATP-grasp Dala_Dala_lig_C ATP-grasp_3 GARS_A RimK ATP-grasp_4 ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: ATA20343
UniProt: A0A250B269
LinkDB All DBs
Position
complement(3047976..3049325)
Genome map
AA seq 449 aa AA seqDB search
MLDKIVIANRGEIALRILRACKELGIKTVAVHSSADRDLKHVLLADETVCIGPAPSTKSY
LNIPAIISAAEITGAVAIHPGYGFLSENADFAEQVERSGFIFIGPKAETIRLMGDKVSAI
TAMKKAGVPCVPGSDGPLTDDMDKNRAFAKRIGYPVIIKASGGGGGRGMRVVRSDKELEQ
SINMTRAEAKAAFNNDMVYMEKYLENPRHIEIQVLADGQGSAIYLAERDCSMQRRHQKVV
EEAPAPGITSEQRKFIGERCAKACVEIGYRGAGTFEFLYENGEFYFIEMNTRIQVEHPVT
EMITGVDLIKEQLRVAAGQPLSIKQEEVKVHGHAVECRINAEDPNNFLPSPGKITRFHAP
GGFGVRWESHIYAGYTVPPYYDSMIGKLITYGENRDVAIARMKNALAELIIDGIKTNVEL
QQKIMNDENFQHGGTNIHYLEKKLGLQEH
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgcttgataaaattgttatcgccaaccgtggcgagattgcgctgcgtattctgcgcgcc
tgtaaagagctgggcatcaagaccgttgccgtccactccagcgcagaccgcgatctgaaa
cacgtcctgttggctgacgagaccgtgtgcatcggcccggcgccgtcaaccaaaagctac
ctgaacatcccggcgattatctcggcggcggaaatcaccggtgcggtggcgatccacccc
ggttacggcttcctgtccgaaaacgccgactttgccgagcaggttgagcgctccggcttt
attttcatcggcccgaaagccgaaaccatccgcctgatgggcgataaagtttccgccatc
accgcgatgaaaaaagccggcgtgccgtgcgtgccgggttcagacggcccgctgaccgac
gacatggataaaaaccgcgcctttgccaaacgcatcggttacccggtgattatcaaggcg
tccggcggcggcggcggccgcggcatgcgcgtagtgcgcagcgacaaagagctggaacag
tccatcaacatgacccgtgcggaagccaaagcggctttcaataacgacatggtgtacatg
gaaaaatacctggaaaacccgcgccacatcgaaattcaggtgttggcggacggccagggc
agcgccatctatctggccgaacgcgactgctccatgcagcgccgccaccagaaagtggtc
gaagaagcgccagcgccgggcattaccagcgaacagcgtaaatttatcggtgaacgttgt
gcgaaagcctgcgtggaaatcggctatcgcggcgccggcacctttgagttcctgtatgaa
aacggcgagttctatttcatcgaaatgaacacccgtatccaggtagaacacccggttacc
gaaatgatcaccggcgtggatctgatcaaagagcaactgcgcgttgcggccggccagccg
ctgtcgatcaaacaggaagaggtcaaggttcacggccatgcggtggaatgccgtatcaac
gccgaagatccgaacaacttcctgccaagcccgggcaagatcacccgtttccatgcgcca
ggtggcttcggcgtgcgttgggaatcccatatctacgccggttataccgtgccgccgtac
tatgattccatgatcggcaagctgatcacctacggtgaaaaccgtgacgtggcgatcgcc
aggatgaaaaacgcgctggcggagctgatcatcgacggcatcaaaaccaacgttgaactg
caacagaaaatcatgaacgacgagaatttccagcacggtggcaccaacatccactatctg
gagaaaaaactcggtttgcaggaacactaa

DBGET integrated database retrieval system