KEGG   Gibbsiella quercinecans: AWC35_18660Help
Entry
AWC35_18660       CDS       T05060                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
gqu  Gibbsiella quercinecans
Pathway
gqu00030  Pentose phosphate pathway
gqu01100  Metabolic pathways
gqu01110  Biosynthesis of secondary metabolites
gqu01120  Microbial metabolism in diverse environments
gqu01130  Biosynthesis of antibiotics
gqu01200  Carbon metabolism
gqu01230  Biosynthesis of amino acids
Module
gqu_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
gqu_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:gqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AWC35_18660
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    AWC35_18660
Enzymes [BR:gqu01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     AWC35_18660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N TPP_enzyme_C E1_dh
Motif
Other DBs
NCBI-ProteinID: ATA21205
UniProt: A0A250B534
LinkDB All DBs
Position
complement(4169181..4171187)
Genome map
AA seq 668 aa AA seqDB search
MNIVKQQRRLCANALRTLSMDAVQKAKSGHPGAPMGMADIAEVLWRDYLNHNPANPHWAD
RDRFVLSNGHGSMLIYSLLHLTGYDLPMSELENFRQLHSKTPGHPEYGYTPGVETTTGPL
GQGIANGVGFAIAERTLAAQFNRPGHDIVDHHTYVFMGDGCMMEGISHEVCSLAGTLKLG
KLTAFYDDNGISIDGHIDGWFTDDTAKRFEAYGWHVVRGVDGHDSAAIKAAIEEARQVTD
KPSLLMCKTVIGFGSPNKAGSHDAHGAPLGDAEVAATREKLGWNYPPFVIPQDIYAQWDA
KEAGKAREAAWNAKFAAYAQAFPEQAAEFKRRMSGELPASWQADAKAFVEKLQANPASIA
SRKASQNTLEAFGKVLPEFLGGSADLAPSNLTMWSGSKAINEDLAGNYIHYGVREFGMTA
ITNGIALHGGFLPYSATFLMFVEYARNAVRMAALMKLRNVFVYTHDSIGLGEDGPTHQPV
EQLASLRVTPNMSTWRPCDQVESAVAWQYGIERNDGPTALIFSRQNLAQQPRTAEQLANV
YRGGYVLKDSDGQPELILIATGSEVELAVAAYEQLTAAGRRVRVVSMPSTDAFDKQDAAY
REAVLPAAVSARVAVEAGIADYWYKYVGLNGAVVGMTTFGESAPADLLFKEFGFTVENVV
AKAKALLK
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcgtaaaacaacaaaggcgcttgtgtgcaaacgcgttaagaaccctctctatg
gacgccgtgcaaaaagcaaaatccggccacccgggcgcgcctatggggatggcggacatc
gccgaagtcctgtggcgtgattaccttaaccataaccccgccaacccacactgggccgac
cgcgaccgcttcgtgctctccaacggccacggctcgatgctgatttacagcctgctgcac
ctcaccggttatgacctgccgatgagcgagctggaaaacttccgccagctgcactccaaa
accccgggccacccggaatacggctataccccgggcgtggaaaccaccaccggcccgctg
ggccagggcatcgccaacggcgtgggcttcgccattgccgaacgtactctggcggcgcag
ttcaaccgcccgggccatgacatcgtcgaccaccacacctacgtgttcatgggcgacggc
tgcatgatggaaggtatctcccacgaagtctgctcgctggccggcaccctcaagctcggc
aagctgaccgccttctatgatgacaacggcatctccatcgacggccacatcgacggctgg
ttcaccgacgacaccgccaaacgttttgaagcctacggctggcacgtggtgcgcggcgtg
gacggccacgacagcgcagccatcaaggcggcgattgaagaagcccgccaggtgaccgac
aagccgtcgctgctgatgtgcaagaccgtgattggcttcgggtcgccgaacaaggccggc
tcgcacgatgcgcacggcgccccgctgggcgatgccgaagtggccgccacccgtgaaaaa
ctgggctggaattatccgccgttcgttatcccgcaggacatctacgcccagtgggacgcc
aaagaagccggcaaggcccgtgaagccgcctggaacgccaaattcgccgcctatgcgcaa
gccttcccggaacaggccgccgagttcaaacgccgcatgagcggtgaactgccggccagc
tggcaggcggacgccaaagcctttgtggaaaaactgcaggccaacccggccagtatcgcc
agccgcaaggcctcgcagaatacgctggaagcgttcggcaaggtgctgccggagttcctc
ggcggctccgccgacctggcgccaagcaacctgacgatgtggtccggctccaaagccatc
aacgaagacctggccggcaactacatccactacggggtgcgcgagttcggcatgaccgcc
atcaccaacggcattgcgctgcacggcggtttcctgccgtattcggccaccttcctgatg
tttgtggaatatgcccgcaacgcggtgcgcatggcggcgctgatgaagctgcgcaacgtg
tttgtctacacccacgattccatcggcctgggcgaagacggcccgacccaccagccggtc
gagcagctggccagcctgcgggtgacgccgaacatgagcacctggcgcccgtgcgaccag
gtggaatcggcggtggcctggcagtacggcatcgagcgcaacgacggcccgacggcgctg
attttctcgcgccagaacctggcccagcagccgcgcacagccgaacagctggccaacgta
taccgcggcggctacgtgctgaaagacagcgacgggcagccggagctgatcctgatcgcc
accggttcggaagtggaactggcggttgccgcctatgagcaactgacggcggcagggcgc
cgggtgcgcgtggtctccatgccgtcgaccgatgcgttcgacaaacaggatgcggcctac
cgcgaagcggtgctgccggcggcggtcagcgcgcgggtggcggtggaagcaggtatcgca
gactactggtacaagtacgtgggcctgaacggcgcggtcgtgggcatgaccaccttcggt
gagtcggcgccggcggatctgctgttcaaagagtttggctttacggtagaaaacgtggtc
gccaaagcgaaagcgttattgaaataa

DBGET integrated database retrieval system