KEGG   Gibbsiella quercinecans: AWC35_19075Help
Entry
AWC35_19075       CDS       T05060                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase subunit E1
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
gqu  Gibbsiella quercinecans
Pathway
gqu00020  Citrate cycle (TCA cycle)
gqu00310  Lysine degradation
gqu00380  Tryptophan metabolism
gqu01100  Metabolic pathways
gqu01110  Biosynthesis of secondary metabolites
gqu01120  Microbial metabolism in diverse environments
gqu01130  Biosynthesis of antibiotics
gqu01200  Carbon metabolism
Module
gqu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gqu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AWC35_19075 (sucA)
  09105 Amino acid metabolism
   00310 Lysine degradation
    AWC35_19075 (sucA)
   00380 Tryptophan metabolism
    AWC35_19075 (sucA)
Enzymes [BR:gqu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     AWC35_19075 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: ATA21272
UniProt: A0A250B5R8
LinkDB All DBs
Position
4256766..4259537
Genome map
AA seq 923 aa AA seqDB search
MESPSLYSAALFNGENAGFLDQQYRRWLDAPEQFAEDWQQLFAQTESANPLGSNAAAQQP
VCASALKKQIAVTLLTQAIRHKGHLHARLDPLGLQPVPQIRQLNPQSWGLEAADMQQAFD
ATFGGQQASMPLHQILSLYQTAWCGTTGYEVMHLEDAGEIDWLMSRIEQSAPAAATAPEK
LARLELLTRAEALERYLHTRYVGQKRFSLEGGESTIPAIHALIAQLSRLGVEELVIGMAH
RGRLNVLVNVMGKSPALLYAEFEGKQPQLPGSGDVKYHLGYARNIETAHGAMHLSLACNP
SHLEIVNPVVQGQVRARQDRRSDAARQQVAALLIHGDSALGGLGVNQTTFTLAATRGYTT
GGTVHLVINNQIGFTTSQPQDMRSFRYCTDIAKGAGMPVLHVNGDDVDAVCRAMNLAAEW
RQTFHKDIAIDLVCFRRHGHNESDEPRLTQPQMYQAVDSHPGVRSRYADKLVQQGVLSQQ
QAVEMVAAAREWLDNPAAENRQQDTSHRWDTFDQHGWRPITGTQVSRERIAGWGDTLSCV
PPGFTVHPTVKRQLAQRRAMSLGDQPVDWGMAEALAWASLVEEGYRVRLSGEDAGRGTFS
HRHAVLHDQQQAGSYIPLQHISPQQAAFEVIDSVLNEEALLAWEYGYSTSAPDALTIWEA
QFGDFANGAQVAIDQFVCSGETKWQRYSGLTIILPHGYDGQGPEHSSARPERWLQLCAEN
NMQVVMPSESSQMFHLLRGQVIRPMRKPLIILMSKRLLRAKAAMSELARFTDDSFRPVIG
DPLNLPAKQIRQVILCSGQVYYDALDARQQRGLDDSVAIIRLEQIYPFPTEALAALLAPL
RHCQHWVWLQEEPENQGAWRQIHHHLVALSLGGRWRYAGRPAAAAPATGYGAVHRQQITD
FLNDAFVPGMQEVEKKITAGAEQ
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atggaatcaccctctctgtattctgcggcgctatttaacggagaaaatgccggctttctt
gaccaacaataccggcgctggctcgatgccccggaacagttcgcggaagactggcagcaa
ctctttgcacaaactgaaagcgccaatccccttggcagtaacgcggccgcgcaacaacct
gtttgcgcatcggcgctgaaaaaacagatagccgttactctgctcacgcaggcgatccgt
cacaaaggccacctgcacgcacgtctcgatccgcttgggctgcagcctgtcccgcaaatc
cggcagctcaatccgcaaagttgggggctggaagccgcggatatgcagcaagcctttgat
gccacctttggcggccaacaggccagcatgccgctgcatcagatcctttccctgtatcaa
acggcctggtgcggcaccaccggttacgaagtgatgcatctggaagatgccggtgaaatt
gattggctgatgagccggatagaacaatcggctcccgccgcggccacggcgcccgagaaa
ctggcgcgcctggaacttctcacccgtgctgaagcccttgagcgttacctgcacacccgt
tatgtcgggcaaaagcgcttctcgctggaaggcggcgaaagcaccattccggctattcac
gccctgatcgcgcagctaagccgcctgggagtggaggaattggtgatcggtatggcgcac
cgtgggcggctgaacgtcctggttaacgtgatgggtaaatctcccgctctgctgtacgcc
gaatttgaaggcaagcagccgcagttgcccggctccggggatgttaaataccatctcggt
tacgccagaaatattgaaacggcgcacggcgccatgcacctgtcgctggcctgtaacccc
tcgcacctggagatcgtcaacccggtggtgcagggccaggttcgggcccgccaggatcgg
cgcagcgacgccgctcgccaacaggttgccgcgctgttgatccacggcgactccgcgttg
ggtgggctgggcgtcaaccagaccaccttcaccctggccgccacccgcggttacaccacc
gggggcacggtacatctggtgatcaacaaccagatcggctttaccacctcccagccgcag
gatatgcgctcattccgctactgtaccgatatcgccaaaggcgccggcatgccggtgctg
cacgtcaacggcgatgacgtggatgcggtttgccgggctatgaacctggcggcggagtgg
cgtcagaccttccataaagatatcgccatcgatctggtgtgtttccgcagacacggccat
aacgaaagcgacgagccacgcctgacgcagccgcagatgtaccaggccgtcgatagccat
cccggcgtgcgcagccgctatgccgataaactggttcagcagggcgtgctaagccagcaa
caggccgtggagatggtggcggcggcccgggaatggctggataaccccgccgcggaaaac
cgccagcaggataccagccaccgctgggacacgttcgatcagcatggctggcgcccgatt
actggcactcaggtatcccgtgaacggatcgccggttggggcgacacgctgtcttgcgta
ccgcctggattcaccgtgcaccccaccgtcaaacgccaactggcgcagcgcagggcgatg
tccctgggcgaccagccggtagactggggcatggcggaagcgttggcgtgggcctcccta
gttgaagaaggctaccgggttcgcctctccggtgaagatgccggccgcggcacctttagc
catcgccatgcggtgttgcacgatcagcagcaggccggcagctacatcccgctgcaacac
atcagcccccaacaggcggcctttgaggtgattgattccgtgctcaatgaagaggcgctg
ctggcctgggaatacggctactccaccagcgccccagacgcgttgactatctgggaagcc
cagtttggcgatttcgccaatggcgctcaggtcgccatcgaccagttcgtctgttccggc
gaaaccaaatggcagcgctacagcgggctgaccatcatactgcctcacggctacgacggg
caggggccggagcactcgtccgcgcgcccggaacgctggctccaactgtgtgcggaaaac
aacatgcaggtggtgatgcccagcgaatccagccagatgttccatctgctgcgcggccag
gttatacgcccgatgcgcaaaccgctgattattttgatgagcaagcgtttgttgcgcgcc
aaagccgcaatgagtgagctcgcccgtttcaccgacgatagcttccgcccggtgattggc
gatccgctcaacctgccggcaaaacagatccggcaggtgatcctttgcagcggccaggtg
tattacgacgcattggatgcccgccagcagcgcggcctggatgacagcgtcgccattatc
cgcctcgaacagatctatccgttcccgaccgaagcgcttgccgccttgctggcgccgtta
cgccactgccagcattgggtatggctacaggaagagccggaaaaccagggcgcctggcgg
cagattcatcatcacttggtcgcgctctccctgggcggccgctggcgctatgcgggccgc
ccggccgccgctgcaccggccacaggctatggcgcagtacatcgccagcaaatcaccgac
ttcctcaacgacgcgtttgtcccaggcatgcaggaagtggagaaaaaaataactgcggga
gcagaacaatga

DBGET integrated database retrieval system