KEGG   Gibbsiella quercinecans: AWC35_22025Help
Entry
AWC35_22025       CDS       T05060                                 

Definition
(GenBank) cystine transporter subunit
  KO
K02424  L-cystine transport system substrate-binding protein
Organism
gqu  Gibbsiella quercinecans
Pathway
gqu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:gqu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AWC35_22025
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gqu02000]
    AWC35_22025
   02035 Bacterial motility proteins [BR:gqu02035]
    AWC35_22025
Transporters [BR:gqu02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Cystine transporter
    AWC35_22025
Bacterial motility proteins [BR:gqu02035]
 Flagellar system
  Flagellar assembly proteins
   Chaperones
    AWC35_22025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd NMT1 Phosphonate-bd
Motif
Other DBs
NCBI-ProteinID: ATA22589
UniProt: A0A250B8V7
LinkDB All DBs
Position
4955659..4956459
Genome map
AA seq 266 aa AA seqDB search
MVFSNVRRQLLMGVMAVALVAGLPLKTHAAENLLDKIKQRGTLIVGLEGTYPPFSFQGED
GKLTGFEVDFADALAQHLGVKAKLTPTKWDGMLASLESKRIDVVINQVTISDERKKKYDF
STPYTVSGIQALVKKGNVGEIAKPDDLKGKKVGVGLGTNYEQWLRENVQGVDVRTYDDDP
TKYQDLRVGRIDAILVDRLAALDLVKKTGDTLAVAGPAFSRQEAGVAVRKNNPDLLNAIN
QAIAAMRADGSLAKISEKWFGADVTQ
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggtcttttcaaatgttcgtcgtcaactgctgatgggggtgatggcggtggctctggtc
gccggcctgccgctgaaaacccatgccgcagagaatttactcgacaagattaaacaacgc
ggcacgctgattgtcggcctggagggcacttacccgccgttcagctttcagggcgaagat
ggcaagctcaccggcttcgaagtggactttgccgatgcgttagcccagcatctgggggtt
aaagccaagctgacccccaccaagtgggacggcatgttggcctcgctggaatccaaacgc
attgacgtggtgataaaccaggtgacgatctccgatgagcgtaaaaagaaatacgatttc
tccaccccgtataccgtttccggtattcaggcgctggtgaaaaagggcaatgtgggcgag
atcgccaagccggacgatctgaaaggcaaaaaggtgggcgtgggcctgggcaccaactac
gaacagtggctgcgtgaaaacgtgcagggcgtggatgtgcgcacctatgatgatgatcct
accaaatatcaggatctgcgcgtgggccgcatcgacgccattttggttgaccgcctggcg
gcgctggatctggtgaagaaaaccggcgatacgctggcggttgccggcccggcgttttcg
cgccaggaagcgggcgtggcggtgcgcaaaaacaacccggatctgttgaatgccattaat
caggcgattgccgcgatgcgggccgacggtagcctggcgaaaatctccgagaaatggttt
ggcgcggacgtaacgcaataa

DBGET integrated database retrieval system