KEGG   Gossypium raimondii: 105763285Help
Entry
105763285         CDS       T04129                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
gra  Gossypium raimondii
Pathway
gra00020  Citrate cycle (TCA cycle)
gra00190  Oxidative phosphorylation
gra01100  Metabolic pathways
gra01110  Biosynthesis of secondary metabolites
gra01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    105763285
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    105763285
Enzymes [BR:gra01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     105763285
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 105763285
NCBI-ProteinID: XP_012436894
UniProt: A0A0D2PQ28
LinkDB All DBs
Position
8
AA seq 630 aa AA seqDB search
MWRCVSRSLRAPYSNRSVAANSLRSNISSFFSTHAGSPYTIVDHTYDAVVVGAGGAGLRA
AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ
DAIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCACAADRT
GHALLHTLYGQAMKHNTQFFVEYFALDLLMNSDGSCQGVIALNMEDGTLHRFQASSTILA
TGGYGRTYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGSRGEG
GILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLPPEV
LKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGSDPDSVVPG
LMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIQRPGQKQKPLEKDAGARTIS
WLDKIRNSNGSLPTSNIRLNMQRVMQNNAAVFRTQETLEEGCQLIDKTWESFHDVKLKDR
SLIWNSDLIESIELENLLINACITMHSAEARKESRGAHAREDFTKRDDENWMKHTLGYWE
NEKVRLDYRPVHMNTLDDEVESFPPKARVY
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgctgcgtttctcgtagccttagagctccatattccaacagatcagttgccgct
aactctcttagatctaacatttccagtttcttctccactcatgctgggtccccttataca
atagtggatcatacgtatgatgcagttgtggttggtgctggtggtgcggggctgagagca
gccattggtctttcagagcatggatttaatactgcttgcataactaagcttttcccaact
cgttcacatactgttgcggctcagggtggcataaatgctgctttgggaaatatgactgaa
gatgactggcgatggcacatgtatgacacagttaaaggaagtgattggttaggtgatcag
gatgcaattcaatatatgtgcagggaggcaccaaaagctgtgattgaacttgagaattat
gggctgcctttttctcgaacagaagatgggaaaatatatcagagagcatttggtggtcaa
agcctagactttggaaaaggtggacaggcttatcgttgtgcatgtgctgctgatcgaacg
gggcatgctctactgcacactctctatggccaagctatgaaacataatacccaattcttt
gtggaatattttgctctggatctattgatgaacagtgatggaagctgccagggagtgata
gctttaaacatggaggacggaacactacatcgcttccaggcttcttcaacaattctggcc
acagggggatatggtagaacctacttttctgcaacttcagctcacacatgcactggtgat
ggcaatgctatggttgcacgtgctgggcttcccctccaggatttggagtttgtgcagttc
catccaactggaatctatggggctgggtgcctcattactgaagggtctcgtggtgaaggt
ggcatccttagaaatagtgaaggtgaacgcttcatggaacggtatgctcctacagccaag
gatcttgcttcaagggacgttgtttcgagatctatgaccatggaaatcagggaaggtcgt
ggtgtaggacctttgaaggatcatatctatctccacttgaatcacttgcctccagaggtg
cttaaggagaggcttccaggtatctctgagactgctgccatttttgctggtgtggatgtt
acgaaggagcccatcccagtcttgcctactgtacattataacatgggtggaattccaaca
aatcatcatggagaggtagttactatcaaaggcagtgatccagattctgtggttcctgga
ctgatggctgctggagaggcagcctgtgcatcagttcatggtgctaatcggttgggtgca
aattcccttcttgacattgtcgtctttggtcgggcttgtgcaaaccgagttgcagagatc
caaaggccagggcagaagcagaaacctttggaaaaggatgctggtgcgagaacaatttca
tggttggacaaaataagaaattctaatggttctcttccaacttcaaacattcgattaaat
atgcaacgagtaatgcaaaataatgctgctgttttccgcacacaggaaacacttgaggaa
ggttgtcagttaattgataagacatgggaaagcttccatgatgttaagttgaaggatcgc
agtttaatatggaactctgatttgatagaatctatcgagttggaaaatcttttgataaat
gcctgtatcaccatgcactccgctgaagctaggaaagagagcagaggagcacatgctcgt
gaagattttacgaaaagagatgatgagaactggatgaaacacacattgggttattgggag
aatgagaaagtgagactggattatcggccagttcacatgaacacattagatgatgaagtc
gagtcattcccacctaaagctcgtgtctattaa

DBGET integrated database retrieval system