KEGG   Gossypium raimondii: 105765246Help
Entry
105765246         CDS       T04129                                 

Definition
(RefSeq) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
gra  Gossypium raimondii
Pathway
gra00330  Arginine and proline metabolism
gra01100  Metabolic pathways
gra01110  Biosynthesis of secondary metabolites
gra01230  Biosynthesis of amino acids
Module
gra_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:gra00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    105765246
Enzymes [BR:gra01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     105765246
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NAD_binding_2 FAD_binding_4 NAD_Gly3P_dh_N DapB_N GFO_IDH_MocA
Motif
Other DBs
NCBI-GeneID: 105765246
NCBI-ProteinID: XP_012439734
LinkDB All DBs
Position
1
AA seq 277 aa AA seqDB search
MEAVPIQSENFKLGFIGAGKMAESIARGVVQSGVLPPQRISTAIHSNPSRGTPFQSLGIS
VYSHNTDVVDASDVIIFSVKPQVVVKNVVLQLRPLLSKKKLLVSIAAGVKLQDLEEWAGH
GRFIRVMPNTPSAVGMGASVMSLGGAATEQDGELVGKLFGAVGKTWKADEKLFDAVTGLS
GSGPAYIYLAIEALADGGVTAGLPRELALGLASQTVLGAAAMAVQSGKHPGQLKDDVTSP
GGTTIAGIHELEKNGFRGTLMNAVVAAAKRSQELSRK
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggaggcagtgcctatacagagtgaaaacttcaagctggggttcattggagcagggaaa
atggcagagagcattgccagaggagtggtacaatctggtgttttgcctccccaacgcatt
tctacagcaatccactcaaatcccagtcgtggtactcccttccagtcactcggcatctct
gtttatagtcacaacaccgacgttgtggatgctagtgatgtgataattttttctgtgaaa
ccccaagtagtagttaaaaatgtggtcttgcagctgaggccgttactttcaaagaaaaag
ctcttggtttcaattgctgcaggagtaaaactgcaggatctggaagagtgggctggccat
ggccgatttatccgggtgatgcctaacactccatctgctgttggtatgggagcttcagtt
atgagcttgggaggagctgcaacagaacaggatggggaattagttggtaaattatttgga
gcagttggcaagacatggaaagctgatgagaaactgtttgatgctgtcactggccttagt
ggcagtggtcccgcttatatatatttagcaattgaagctttggctgatgggggagtgact
gctggtcttccgcgagaactagcattgggacttgcttctcaaactgttttgggagcagct
gctatggctgttcaatctgggaagcaccctggtcagctgaaagacgatgttacatcacct
ggtgggactacaattgccggcattcatgagttagagaagaatggtttccggggaacattg
atgaatgcagttgtggcagctgctaagcgtagccaagaactttccaggaagtag

DBGET integrated database retrieval system