KEGG   Gossypium raimondii: 105765714Help
Entry
105765714         CDS       T04129                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B4, mitochondrial-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
gra  Gossypium raimondii
Pathway
gra00010  Glycolysis / Gluconeogenesis
gra00053  Ascorbate and aldarate metabolism
gra00071  Fatty acid degradation
gra00280  Valine, leucine and isoleucine degradation
gra00310  Lysine degradation
gra00330  Arginine and proline metabolism
gra00340  Histidine metabolism
gra00380  Tryptophan metabolism
gra00410  beta-Alanine metabolism
gra00561  Glycerolipid metabolism
gra00620  Pyruvate metabolism
gra00903  Limonene and pinene degradation
gra01100  Metabolic pathways
gra01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105765714
   00053 Ascorbate and aldarate metabolism
    105765714
   00620 Pyruvate metabolism
    105765714
  09103 Lipid metabolism
   00071 Fatty acid degradation
    105765714
   00561 Glycerolipid metabolism
    105765714
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    105765714
   00310 Lysine degradation
    105765714
   00330 Arginine and proline metabolism
    105765714
   00340 Histidine metabolism
    105765714
   00380 Tryptophan metabolism
    105765714
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    105765714
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    105765714
Enzymes [BR:gra01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     105765714
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1350 AAA_25
Motif
Other DBs
NCBI-GeneID: 105765714
NCBI-ProteinID: XP_012440392
UniProt: A0A0D2TF32
LinkDB All DBs
Position
8
AA seq 541 aa AA seqDB search
MAARRISSLLTRSLSVSSSSVSTSLFSSLGKNSGRNGIGKRFSTAAALEDLIVPPVQIAY
TQNLIDGKFVDAASGKTFPTYDPRTGDVIANVAEGDAEDIDRAVAAARKAFDEGPWPKMT
PYERSRIMLRFADLVEKHSEELAALETWNNGKPHEQSAKSELPMFIRLFHYYAGWADKIH
GLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLIMFAWKVGPALACGNTIVLKTAEQTPLT
ALYVAKLFHEAGLPPGVLNVVSGYGPTAGAALASHMDVDKVAFTGSTDTGKIVLELAAKS
NLKPVTLELGGKSPFIICEDADVDKAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFLE
KAKARALRRVVGDPFRKGVEQGPQIDTEQFEKVLRYIRAGIESNATLECGGDRLGTKGYF
VQPTVFSNVMDDMLIAKDEIFGPVQSILKFKDIDEVIRRANNTRYGLAAGVFTKSVETAN
TLTRALRAGTVWVNCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVTPLKNPAW
L
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggcagctcgtagaatctcttcactacttactcgttcactctctgtttcttcttcatct
gtttctacttctttgttttcatctctagggaaaaacagtggcagaaatggaattgggaaa
agattcagcacagctgcagctcttgaggatctgattgttccaccggttcaaatagcttac
actcagaatttaattgatgggaaatttgtagatgccgcatctgggaaaacatttccaact
tatgaccctcgtacaggggatgtgattgccaatgttgctgaaggtgatgccgaggatatt
gaccgagcggttgccgccgctcgcaaggcattcgatgagggaccgtggccgaaaatgact
ccctatgaacggtcacggataatgttgcggtttgctgatttggtcgagaaacatagcgag
gaacttgcagcactagagacatggaacaacggaaagccacacgagcagtctgcgaaatct
gaattgccgatgttcatacgtctttttcactactatgctggttgggcggataagatccat
gggttaacggttccggctgatggacctcatcatgttcagacattgcacgagccgataggt
gttgcaggacagataattccatggaactttcctcttattatgtttgcttggaaggttggg
cctgcattggcttgtggaaataccattgttttgaagactgctgagcaaactcctttgact
gctctctatgtggctaagctgttccatgaggctggtctccctccaggtgttctgaatgta
gtttcaggctatggtccgacagccggtgctgctcttgccagccacatggatgttgacaag
gtagcattcacaggatcaaccgataccggtaagattgtacttgaattagccgcaaaaagc
aatcttaagccggtgacgttagagcttggagggaaatcgcctttcataatatgcgaagat
gctgatgtcgataaagccgtggagcttgctcattttgctttgttctttaatcaggggcaa
tgttgctgtgccgggtctcgcacttttgttcacgaacgtgtttacgatgaattcctagag
aaagcaaaggcacgtgcattgaggcgtgttgttggtgatcctttcaggaagggtgtcgaa
caaggtcctcagattgacacagagcagtttgagaaagttttaagatacataagagcaggc
atcgaaagcaacgcaacccttgaatgcggaggtgacagacttggaacgaaaggatacttt
gtccaaccaaccgttttctcaaacgttatggatgatatgctgatagcaaaagacgaaatc
ttcggtccagtacaatctatcctaaagttcaaggatattgatgaagtaattcgaagggcg
aacaacacccgttacggtttagcagctggagttttcaccaagagtgtagagacagcgaat
accttgactcgtgcgttaagggccgggacagtttgggttaactgttttgatgtgtttgat
gctgcaattccatttggtgggtacaaaatgagtggcattggtagggaaaaggggatctac
agtcttcataattatttgcaggtaaaggcagttgttactcctttgaagaatccagcatgg
ttgtaa

DBGET integrated database retrieval system